BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0414 (326 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0228 + 1692117-1692924,1693321-1693431,1693536-1693675,169... 26 8.0 >05_01_0228 + 1692117-1692924,1693321-1693431,1693536-1693675, 1693865-1694075,1694148-1694415,1694543-1694696, 1694795-1695123,1695748-1695835 Length = 702 Score = 25.8 bits (54), Expect = 8.0 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -2 Query: 286 RVFFFFFLCNYE*MNLWPNTW*VQKILTKSNKTLPSKCRHPL*DVR 149 +VF LC NL P W V ++L N LP + P +++ Sbjct: 593 KVFHVGLLCAQASPNLRPPMWKVVEMLGSRNNELPRPTQPPFINIK 638 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,854,621 Number of Sequences: 37544 Number of extensions: 118348 Number of successful extensions: 123 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 435246480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -