BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0412 (739 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 23 2.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.9 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 21 7.9 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 23.0 bits (47), Expect = 2.6 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = -3 Query: 623 VCENSSLGSHCAGGNTWSTSTDIWEYVELECLC*FMF*FALIVYGENSYNRNTDSL 456 +C SHC GG T +W Y ++ C F + F ++ + N N+ SL Sbjct: 318 ICNEEERNSHCLGGTITRT---MW-YFQI-CGSAFSYLFIMLQFDLN--NKKNQSL 366 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/39 (30%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 184 NCS---ICRPGLSDKPK*LGNICAQSDKARCVYRTGRCC 291 NC+ +CR GLS N+ +C Y G C Sbjct: 571 NCAAYYVCRSGLSYHLSCAENMMFDPMSGKCEYSLGEKC 609 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 249 IRQGEVCLPDGPLLLNPTSL 308 +R G+ CL GP +P SL Sbjct: 125 VRDGKPCLSGGPKHPDPGSL 144 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,611 Number of Sequences: 336 Number of extensions: 3626 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -