BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0412 (739 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 0.74 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 22 5.2 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 6.9 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 6.9 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 9.1 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 25.0 bits (52), Expect = 0.74 Identities = 8/30 (26%), Positives = 14/30 (46%) Frame = +1 Query: 565 LVDQVFPPAQCEPSDEFSQTVYWRDPLPAV 654 L+ + C+P+ + WR P PA+ Sbjct: 15 LLSNAYKQGFCQPTQRTMSKIQWRKPKPAM 44 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/26 (34%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -3 Query: 494 YGENSYNRNTDSLICTNVIH--SIPI 423 Y ++YN N +C N+ H IP+ Sbjct: 89 YNYSNYNNNNYKQLCYNINHIEQIPV 114 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 6.9 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 179 ISTALSVGQGYRTSQS 226 +ST ++ QG+RT++S Sbjct: 275 VSTTKAINQGFRTTKS 290 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.8 bits (44), Expect = 6.9 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 186 LLYLSARAIGQAKVTREYLRSI 251 LLY AR + Q ++EYL SI Sbjct: 219 LLYNHARLMSQDNHSKEYLVSI 240 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/21 (33%), Positives = 9/21 (42%) Frame = -1 Query: 577 PGPPALTYGNTWNWNVCVSSC 515 PG A+ + W WN C Sbjct: 28 PGHDAIVHLFEWKWNDIAKEC 48 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,383 Number of Sequences: 438 Number of extensions: 4218 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -