BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0411 (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 79 2e-15 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 79 2e-15 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 79 2e-15 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 66 3e-11 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 64 1e-10 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 60 1e-09 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 58 6e-09 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 57 1e-08 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 57 1e-08 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 57 1e-08 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 57 1e-08 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 57 1e-08 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 57 1e-08 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 57 1e-08 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 57 1e-08 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 57 1e-08 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 57 1e-08 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 57 1e-08 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 57 1e-08 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 57 1e-08 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 57 1e-08 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 57 1e-08 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 57 1e-08 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 57 1e-08 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 57 1e-08 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 57 1e-08 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 57 1e-08 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 57 1e-08 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 57 1e-08 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 57 1e-08 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 57 1e-08 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 57 1e-08 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 57 1e-08 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 57 1e-08 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 57 1e-08 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 57 1e-08 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 57 1e-08 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 57 1e-08 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 57 1e-08 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 57 1e-08 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 57 1e-08 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 57 1e-08 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 57 1e-08 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 57 1e-08 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 57 1e-08 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 57 1e-08 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 57 1e-08 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 57 1e-08 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 57 1e-08 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 57 1e-08 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 57 1e-08 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 57 1e-08 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 57 1e-08 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 57 1e-08 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 57 1e-08 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 57 1e-08 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 57 1e-08 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 57 1e-08 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 57 1e-08 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 57 1e-08 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 57 1e-08 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 57 1e-08 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 57 1e-08 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 57 1e-08 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 57 1e-08 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 57 1e-08 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 57 1e-08 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 57 1e-08 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 57 1e-08 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 57 1e-08 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 57 1e-08 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 57 1e-08 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 57 1e-08 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 57 1e-08 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 57 1e-08 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 57 1e-08 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25610| Best HMM Match : MAT_Alpha1 (HMM E-Value=7.2) 57 1e-08 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 57 1e-08 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25265| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 91.9 bits (218), Expect = 4e-19 Identities = 42/46 (91%), Positives = 42/46 (91%) Frame = -2 Query: 652 SLLRQLAKGGCAARRLSWVTPGFSPVTTVVKRRPVNCNTTHYRANW 515 SLLRQLAKGGCAARRLSWVTPGF P VVKRRPVNCNTTHYRANW Sbjct: 36 SLLRQLAKGGCAARRLSWVTPGF-PSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 79.4 bits (187), Expect = 2e-15 Identities = 39/46 (84%), Positives = 39/46 (84%) Frame = -2 Query: 652 SLLRQLAKGGCAARRLSWVTPGFSPVTTVVKRRPVNCNTTHYRANW 515 SLLRQLAKGGCAARRLSW GF P VVKRRPVNCNTTHYRANW Sbjct: 607 SLLRQLAKGGCAARRLSW---GF-PSHDVVKRRPVNCNTTHYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 79.4 bits (187), Expect = 2e-15 Identities = 39/46 (84%), Positives = 39/46 (84%) Frame = -2 Query: 652 SLLRQLAKGGCAARRLSWVTPGFSPVTTVVKRRPVNCNTTHYRANW 515 SLLRQLAKGGCAARRLSW GF P VVKRRPVNCNTTHYRANW Sbjct: 50 SLLRQLAKGGCAARRLSW---GF-PSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 79.4 bits (187), Expect = 2e-15 Identities = 39/46 (84%), Positives = 39/46 (84%) Frame = -2 Query: 652 SLLRQLAKGGCAARRLSWVTPGFSPVTTVVKRRPVNCNTTHYRANW 515 SLLRQLAKGGCAARRLSW GF P VVKRRPVNCNTTHYRANW Sbjct: 50 SLLRQLAKGGCAARRLSW---GF-PSHDVVKRRPVNCNTTHYRANW 91 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 65.7 bits (153), Expect = 3e-11 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 653 FAITPAGERGMCCKAIKLGNARVFPSHDGCK 561 FAITPAGERGMCCKAIKLGNAR FPSHDG K Sbjct: 53 FAITPAGERGMCCKAIKLGNARGFPSHDGEK 83 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 562 KRRPVNCNTTHYRAN 518 KRRPVNCNTTHYRAN Sbjct: 83 KRRPVNCNTTHYRAN 97 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 64.9 bits (151), Expect = 5e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 561 FTTVVTGENPGVTQLNRLAAHPPFASWRNSE 653 F VVTG+NPGVTQLNRLAAHPPFASWRNSE Sbjct: 11 FYNVVTGKNPGVTQLNRLAAHPPFASWRNSE 41 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 533 SRITIHWPSFYN 568 SRITIHWPSFYN Sbjct: 2 SRITIHWPSFYN 13 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 63.7 bits (148), Expect = 1e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 653 FAITPAGERGMCCKAIKLGNARVFPSHDGCK 561 FAITPAGERGMCCKAIKLGNA VFPSHD K Sbjct: 8 FAITPAGERGMCCKAIKLGNASVFPSHDVVK 38 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -2 Query: 580 PVTTVVKRRPVNCNTTHYRANW 515 P VVKRRPVNCNTTHYRANW Sbjct: 32 PSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 63.7 bits (148), Expect = 1e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 653 FAITPAGERGMCCKAIKLGNARVFPSHDGCK 561 FAITPAGERGMCCKAIKLGNA VFPSHD K Sbjct: 22 FAITPAGERGMCCKAIKLGNASVFPSHDVVK 52 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -2 Query: 580 PVTTVVKRRPVNCNTTHYRANW 515 P VVKRRPVNCNTTHYRANW Sbjct: 46 PSHDVVKRRPVNCNTTHYRANW 67 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 62.9 bits (146), Expect = 2e-10 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 549 TGRRFTTVVTGENPGVTQLNRLAAHPPFASWRNSE 653 TGRRFT ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 40 TGRRFTRR-DWENPGVTQLNRLAAHPPFASWRNSE 73 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 62.1 bits (144), Expect = 4e-10 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 653 FAITPAGERGMCCKAIKLGNARVFPSHDGCK 561 FAITPAGERGMCCKAIKLGNA+ FPSHD K Sbjct: 14 FAITPAGERGMCCKAIKLGNAKGFPSHDVVK 44 Score = 48.0 bits (109), Expect = 7e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -2 Query: 589 GFSPVTTVVKRRPVNCNTTHYRANW 515 GF P VVKRRPVNCNTTHYRANW Sbjct: 36 GF-PSHDVVKRRPVNCNTTHYRANW 59 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 61.7 bits (143), Expect = 5e-10 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 561 FTTVVTGENPGVTQLNRLAAHPPFASWRNSE 653 F VVTG+N GVTQLNRLAAHPPFASWRNSE Sbjct: 11 FYNVVTGKNTGVTQLNRLAAHPPFASWRNSE 41 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 533 SRITIHWPSFYN 568 SRITIHWPSFYN Sbjct: 2 SRITIHWPSFYN 13 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 61.7 bits (143), Expect = 5e-10 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 561 FTTVVTGENPGVTQLNRLAAHPPFASWRNSE 653 F VVTG+N GVTQLNRLAAHPPFASWRNSE Sbjct: 11 FYNVVTGKNTGVTQLNRLAAHPPFASWRNSE 41 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 533 SRITIHWPSFYN 568 SRITIHWPSFYN Sbjct: 2 SRITIHWPSFYN 13 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 60.9 bits (141), Expect = 9e-10 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 570 VVTGENPGVTQLNRLAAHPPFASWRNSE 653 VVTG+ PGVTQLNRLAAHPPFASWRNSE Sbjct: 14 VVTGKTPGVTQLNRLAAHPPFASWRNSE 41 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +3 Query: 561 FTTVVTGENPGVTQLNRLAAHPPFASWRNSE 653 F VV ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 11 FYNVVHWENPGVTQLNRLAAHPPFASWRNSE 41 Score = 36.3 bits (80), Expect = 0.022 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +2 Query: 533 SRITIHWPSFYNRRDWGKP 589 SRITIHWPSFYN W P Sbjct: 2 SRITIHWPSFYNVVHWENP 20 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 60.5 bits (140), Expect = 1e-09 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 653 FAITPAGERGMCCKAIKLGNARVFPSHDGCKTTAS 549 FAITPAGERGMCCKAIKLGNARVFP KTTAS Sbjct: 29 FAITPAGERGMCCKAIKLGNARVFPV-TTFKTTAS 62 >SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 579 GENPGVTQLNRLAAHPPFASWRNSE 653 GENPGVTQLNRLAAHPPFASWRNSE Sbjct: 38 GENPGVTQLNRLAAHPPFASWRNSE 62 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 58.4 bits (135), Expect = 5e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +3 Query: 561 FTTVVTGENPGVTQLNRLAAHPPFASWRNSE 653 F VVTG+ GVTQLNRLAAHPPFASWRNSE Sbjct: 9 FYNVVTGKTLGVTQLNRLAAHPPFASWRNSE 39 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 58.4 bits (135), Expect = 5e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 652 SLLRQLAKGGCAARRLSWVTPGFSPVTTVVKRRPV 548 SLLRQLAKGGCAARRLSWVTPGFS + KRRPV Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQ-SRRCKRRPV 48 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 58.4 bits (135), Expect = 5e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 652 SLLRQLAKGGCAARRLSWVTPGFSPVTTVVKRRPV 548 SLLRQLAKGGCAARRLSWVTPGFS + KRRPV Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQ-SRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 58.4 bits (135), Expect = 5e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 652 SLLRQLAKGGCAARRLSWVTPGFSPVTTVVKRRPV 548 SLLRQLAKGGCAARRLSWVTPGFS + KRRPV Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQ-SRRCKRRPV 48 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 58.4 bits (135), Expect = 5e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 652 SLLRQLAKGGCAARRLSWVTPGFSPVTTVVKRRPV 548 SLLRQLAKGGCAARRLSWVTPGFS + KRRPV Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQ-SRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 58.4 bits (135), Expect = 5e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 652 SLLRQLAKGGCAARRLSWVTPGFSPVTTVVKRRPV 548 SLLRQLAKGGCAARRLSWVTPGFS + KRRPV Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQ-SRRCKRRPV 48 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 58.4 bits (135), Expect = 5e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 652 SLLRQLAKGGCAARRLSWVTPGFSPVTTVVKRRPV 548 SLLRQLAKGGCAARRLSWVTPGFS + KRRPV Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQ-SRRCKRRPV 48 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 58.4 bits (135), Expect = 5e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 652 SLLRQLAKGGCAARRLSWVTPGFSPVTTVVKRRPV 548 SLLRQLAKGGCAARRLSWVTPGFS + KRRPV Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQ-SRRCKRRPV 48 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 58.0 bits (134), Expect = 6e-09 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = +3 Query: 549 TGRRFTTVVTGENPGVTQLNRLAAHPPFASWRNSE 653 TGRR ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 15 TGRRLQRR-DWENPGVTQLNRLAAHPPFASWRNSE 48 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 58.0 bits (134), Expect = 6e-09 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = +3 Query: 549 TGRRFTTVVTGENPGVTQLNRLAAHPPFASWRNSE 653 TGRR ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 35 TGRRLQRR-DWENPGVTQLNRLAAHPPFASWRNSE 68 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 58.0 bits (134), Expect = 6e-09 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = +3 Query: 549 TGRRFTTVVTGENPGVTQLNRLAAHPPFASWRNSE 653 TGRR ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 25 TGRRLQRR-DWENPGVTQLNRLAAHPPFASWRNSE 58 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 58.0 bits (134), Expect = 6e-09 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = +3 Query: 549 TGRRFTTVVTGENPGVTQLNRLAAHPPFASWRNSE 653 TGRR ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 45 TGRRLQRR-DWENPGVTQLNRLAAHPPFASWRNSE 78 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 58.0 bits (134), Expect = 6e-09 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 653 FAITPAGERGMCCKAIKLGNARVFPSHDGCK 561 FAITPAGERGMCCK+IKL +A VFPSHD K Sbjct: 16 FAITPAGERGMCCKSIKLAHASVFPSHDVVK 46 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -2 Query: 580 PVTTVVKRRPVNCNTTHYRANW 515 P VVKRRPVNCNTTHYRANW Sbjct: 40 PSHDVVKRRPVNCNTTHYRANW 61 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 58.0 bits (134), Expect = 6e-09 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = +3 Query: 549 TGRRFTTVVTGENPGVTQLNRLAAHPPFASWRNSE 653 TGRR ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 72 TGRRLQRR-DWENPGVTQLNRLAAHPPFASWRNSE 105 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 45 ENPGVTQLNRLAAHPPFASWRNSE 68 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSE 95 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 54 ENPGVTQLNRLAAHPPFASWRNSE 77 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSE 69 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSE 95 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 77 ENPGVTQLNRLAAHPPFASWRNSE 100 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 48 ENPGVTQLNRLAAHPPFASWRNSE 71 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSE 91 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 80 ENPGVTQLNRLAAHPPFASWRNSE 103 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 56 ENPGVTQLNRLAAHPPFASWRNSE 79 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 45 ENPGVTQLNRLAAHPPFASWRNSE 68 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 35 ENPGVTQLNRLAAHPPFASWRNSE 58 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 60 ENPGVTQLNRLAAHPPFASWRNSE 83 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 69 ENPGVTQLNRLAAHPPFASWRNSE 92 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 63 ENPGVTQLNRLAAHPPFASWRNSE 86 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 79 ENPGVTQLNRLAAHPPFASWRNSE 102 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSE 90 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNSE 73 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 226 ENPGVTQLNRLAAHPPFASWRNSE 249 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 121 ENPGVTQLNRLAAHPPFASWRNSE 144 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 59 ENPGVTQLNRLAAHPPFASWRNSE 82 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 38 ENPGVTQLNRLAAHPPFASWRNSE 61 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSE 49 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 57 ENPGVTQLNRLAAHPPFASWRNSE 80 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 391 ENPGVTQLNRLAAHPPFASWRNSE 414 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 117 ENPGVTQLNRLAAHPPFASWRNSE 140 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 93 ENPGVTQLNRLAAHPPFASWRNSE 116 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSE 72 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 18 ENPGVTQLNRLAAHPPFASWRNSE 41 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 28 ENPGVTQLNRLAAHPPFASWRNSE 51 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 48 ENPGVTQLNRLAAHPPFASWRNSE 71 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 113 ENPGVTQLNRLAAHPPFASWRNSE 136 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 55 ENPGVTQLNRLAAHPPFASWRNSE 78 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 350 ENPGVTQLNRLAAHPPFASWRNSE 373 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 90 ENPGVTQLNRLAAHPPFASWRNSE 113 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 60 ENPGVTQLNRLAAHPPFASWRNSE 83 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSE 49 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 69 ENPGVTQLNRLAAHPPFASWRNSE 92 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 53 ENPGVTQLNRLAAHPPFASWRNSE 76 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 144 ENPGVTQLNRLAAHPPFASWRNSE 167 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 73 ENPGVTQLNRLAAHPPFASWRNSE 96 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSE 72 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 153 ENPGVTQLNRLAAHPPFASWRNSE 176 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 843 ENPGVTQLNRLAAHPPFASWRNSE 866 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSE 49 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 70 ENPGVTQLNRLAAHPPFASWRNSE 93 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSE 67 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 83 ENPGVTQLNRLAAHPPFASWRNSE 106 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 66 ENPGVTQLNRLAAHPPFASWRNSE 89 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 79 ENPGVTQLNRLAAHPPFASWRNSE 102 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 75 ENPGVTQLNRLAAHPPFASWRNSE 98 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 266 ENPGVTQLNRLAAHPPFASWRNSE 289 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 124 ENPGVTQLNRLAAHPPFASWRNSE 147 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 60 ENPGVTQLNRLAAHPPFASWRNSE 83 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSE 69 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 47 ENPGVTQLNRLAAHPPFASWRNSE 70 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 111 ENPGVTQLNRLAAHPPFASWRNSE 134 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 124 ENPGVTQLNRLAAHPPFASWRNSE 147 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSE 72 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSE 53 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSE 91 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 47 ENPGVTQLNRLAAHPPFASWRNSE 70 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSE 67 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 21 ENPGVTQLNRLAAHPPFASWRNSE 44 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 ENPGVTQLNRLAAHPPFASWRNSE 52 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 406 ENPGVTQLNRLAAHPPFASWRNSE 429 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 55 ENPGVTQLNRLAAHPPFASWRNSE 78 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 64 ENPGVTQLNRLAAHPPFASWRNSE 87 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSE 69 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 129 ENPGVTQLNRLAAHPPFASWRNSE 152 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 65 ENPGVTQLNRLAAHPPFASWRNSE 88 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 75 ENPGVTQLNRLAAHPPFASWRNSE 98 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 78 ENPGVTQLNRLAAHPPFASWRNSE 101 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 424 ENPGVTQLNRLAAHPPFASWRNSE 447 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 121 ENPGVTQLNRLAAHPPFASWRNSE 144 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 77 ENPGVTQLNRLAAHPPFASWRNSE 100 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 66 ENPGVTQLNRLAAHPPFASWRNSE 89 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 56 ENPGVTQLNRLAAHPPFASWRNSE 79 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 171 ENPGVTQLNRLAAHPPFASWRNSE 194 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 75 ENPGVTQLNRLAAHPPFASWRNSE 98 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 62 ENPGVTQLNRLAAHPPFASWRNSE 85 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 98 ENPGVTQLNRLAAHPPFASWRNSE 121 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 47 ENPGVTQLNRLAAHPPFASWRNSE 70 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 73 ENPGVTQLNRLAAHPPFASWRNSE 96 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 52 ENPGVTQLNRLAAHPPFASWRNSE 75 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 195 ENPGVTQLNRLAAHPPFASWRNSE 218 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSE 67 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNSE 73 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 64 ENPGVTQLNRLAAHPPFASWRNSE 87 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 61 ENPGVTQLNRLAAHPPFASWRNSE 84 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSE 67 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 45 ENPGVTQLNRLAAHPPFASWRNSE 68 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 59 ENPGVTQLNRLAAHPPFASWRNSE 82 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSE 72 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 142 ENPGVTQLNRLAAHPPFASWRNSE 165 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 51 ENPGVTQLNRLAAHPPFASWRNSE 74 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 94 ENPGVTQLNRLAAHPPFASWRNSE 117 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 32 ENPGVTQLNRLAAHPPFASWRNSE 55 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 163 ENPGVTQLNRLAAHPPFASWRNSE 186 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 350 ENPGVTQLNRLAAHPPFASWRNSE 373 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSE 90 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 31 ENPGVTQLNRLAAHPPFASWRNSE 54 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 57 ENPGVTQLNRLAAHPPFASWRNSE 80 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 119 ENPGVTQLNRLAAHPPFASWRNSE 142 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 96 ENPGVTQLNRLAAHPPFASWRNSE 119 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSE 69 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 70 ENPGVTQLNRLAAHPPFASWRNSE 93 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 304 ENPGVTQLNRLAAHPPFASWRNSE 327 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSE 90 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSE 91 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSE 49 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSE 69 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 421 ENPGVTQLNRLAAHPPFASWRNSE 444 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 105 ENPGVTQLNRLAAHPPFASWRNSE 128 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 61 ENPGVTQLNRLAAHPPFASWRNSE 84 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 53 ENPGVTQLNRLAAHPPFASWRNSE 76 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 103 ENPGVTQLNRLAAHPPFASWRNSE 126 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 53 ENPGVTQLNRLAAHPPFASWRNSE 76 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 221 ENPGVTQLNRLAAHPPFASWRNSE 244 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 53 ENPGVTQLNRLAAHPPFASWRNSE 76 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 223 ENPGVTQLNRLAAHPPFASWRNSE 246 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 43 ENPGVTQLNRLAAHPPFASWRNSE 66 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 58 ENPGVTQLNRLAAHPPFASWRNSE 81 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 48 ENPGVTQLNRLAAHPPFASWRNSE 71 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 53 ENPGVTQLNRLAAHPPFASWRNSE 76 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 157 ENPGVTQLNRLAAHPPFASWRNSE 180 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 55 ENPGVTQLNRLAAHPPFASWRNSE 78 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 45 ENPGVTQLNRLAAHPPFASWRNSE 68 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 65 ENPGVTQLNRLAAHPPFASWRNSE 88 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNSE 73 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 85 ENPGVTQLNRLAAHPPFASWRNSE 108 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 205 ENPGVTQLNRLAAHPPFASWRNSE 228 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 63 ENPGVTQLNRLAAHPPFASWRNSE 86 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 42 ENPGVTQLNRLAAHPPFASWRNSE 65 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 96 ENPGVTQLNRLAAHPPFASWRNSE 119 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 32 ENPGVTQLNRLAAHPPFASWRNSE 55 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 59 ENPGVTQLNRLAAHPPFASWRNSE 82 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 197 ENPGVTQLNRLAAHPPFASWRNSE 220 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSE 90 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 77 ENPGVTQLNRLAAHPPFASWRNSE 100 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 60 ENPGVTQLNRLAAHPPFASWRNSE 83 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSE 90 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 110 ENPGVTQLNRLAAHPPFASWRNSE 133 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 86 ENPGVTQLNRLAAHPPFASWRNSE 109 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 106 ENPGVTQLNRLAAHPPFASWRNSE 129 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 83 ENPGVTQLNRLAAHPPFASWRNSE 106 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNSE 73 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 59 ENPGVTQLNRLAAHPPFASWRNSE 82 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 673 ENPGVTQLNRLAAHPPFASWRNSE 696 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 58 ENPGVTQLNRLAAHPPFASWRNSE 81 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 47 ENPGVTQLNRLAAHPPFASWRNSE 70 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 38 ENPGVTQLNRLAAHPPFASWRNSE 61 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 156 ENPGVTQLNRLAAHPPFASWRNSE 179 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 48 ENPGVTQLNRLAAHPPFASWRNSE 71 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 69 ENPGVTQLNRLAAHPPFASWRNSE 92 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 98 ENPGVTQLNRLAAHPPFASWRNSE 121 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSE 69 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 110 ENPGVTQLNRLAAHPPFASWRNSE 133 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 53 ENPGVTQLNRLAAHPPFASWRNSE 76 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 1200 ENPGVTQLNRLAAHPPFASWRNSE 1223 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 652 SLLRQLAKGGCAARRLSW 599 SLLRQLAKGGCAARRLSW Sbjct: 422 SLLRQLAKGGCAARRLSW 439 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 52 ENPGVTQLNRLAAHPPFASWRNSE 75 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 42 ENPGVTQLNRLAAHPPFASWRNSE 65 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 135 ENPGVTQLNRLAAHPPFASWRNSE 158 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 66 ENPGVTQLNRLAAHPPFASWRNSE 89 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 87 ENPGVTQLNRLAAHPPFASWRNSE 110 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 60 ENPGVTQLNRLAAHPPFASWRNSE 83 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 136 ENPGVTQLNRLAAHPPFASWRNSE 159 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 178 ENPGVTQLNRLAAHPPFASWRNSE 201 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 41 ENPGVTQLNRLAAHPPFASWRNSE 64 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 90 ENPGVTQLNRLAAHPPFASWRNSE 113 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 40 ENPGVTQLNRLAAHPPFASWRNSE 63 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 55 ENPGVTQLNRLAAHPPFASWRNSE 78 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSE 49 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 85 ENPGVTQLNRLAAHPPFASWRNSE 108 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 935 ENPGVTQLNRLAAHPPFASWRNSE 958 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 354 ENPGVTQLNRLAAHPPFASWRNSE 377 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSE 67 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSE 69 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 56 ENPGVTQLNRLAAHPPFASWRNSE 79 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSE 69 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 106 ENPGVTQLNRLAAHPPFASWRNSE 129 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 363 ENPGVTQLNRLAAHPPFASWRNSE 386 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 93 ENPGVTQLNRLAAHPPFASWRNSE 116 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 582 ENPGVTQLNRLAAHPPFASWRNSE 653 ENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSE 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,664,283 Number of Sequences: 59808 Number of extensions: 384441 Number of successful extensions: 5055 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5040 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -