BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0408 (672 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1587| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) 29 4.5 >SB_1587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1497 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 116 CSYFTHRGKGSDFQYLVMG 172 C+YFTHRG+G Y+V+G Sbjct: 1269 CNYFTHRGRGK--AYVVLG 1285 >SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) Length = 380 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +2 Query: 155 QYLVMGDEMDPCECLWNHELAMRRLISLLRQGQSYCTESECLEQLPGLPQP 307 QY + GD+ D + L +H+++ RLI+ L Q S EC L L P Sbjct: 26 QYNIQGDDSDDDDDL-DHDMSTERLINQLLQVLSSGVSEECPICLDPLDDP 75 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,581,175 Number of Sequences: 59808 Number of extensions: 423984 Number of successful extensions: 987 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1721264831 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -