BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0408 (672 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC008502-1|AAH08502.1| 99|Homo sapiens chromosome 4 open readi... 71 4e-12 Z46629-1|CAA86598.1| 509|Homo sapiens SOX9 protein. 33 0.93 S74506-1|AAB32870.1| 509|Homo sapiens inactivating mutations as... 33 0.93 BT006875-1|AAP35521.1| 509|Homo sapiens SRY (sex determining re... 33 0.93 BC056420-1|AAH56420.1| 509|Homo sapiens SRY (sex determining re... 33 0.93 BC007951-1|AAH07951.1| 509|Homo sapiens SRY (sex determining re... 33 0.93 >BC008502-1|AAH08502.1| 99|Homo sapiens chromosome 4 open reading frame 34 protein. Length = 99 Score = 70.9 bits (166), Expect = 4e-12 Identities = 37/93 (39%), Positives = 50/93 (53%) Frame = +2 Query: 182 DPCECLWNHELAMRRLISLLRQGQSYCTESECLEQLPGLPQPESAGNSXXXXXXXXXXXX 361 DPCEC+ +HE AMRRLI+LLRQ QSYCT++ECL++LPG P ++ + Sbjct: 7 DPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPG-PSGDNGISVTMILVAWMVIAL 65 Query: 362 XXXXXRPRRNQIQDAAKPAHNPHDRDGAPPTPP 460 RP + +PH+ PP PP Sbjct: 66 ILFLLRPPNLRGSSLPGKPTSPHNGQD-PPAPP 97 >Z46629-1|CAA86598.1| 509|Homo sapiens SOX9 protein. Length = 509 Score = 33.1 bits (72), Expect = 0.93 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 411 NQRTILTTVTVLPLHLQEFNQHLPRRLVHPEWSLPPLNSSY 533 +QRT + T + P H E QH P+++ + ++LP + SY Sbjct: 392 SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSY 432 >S74506-1|AAB32870.1| 509|Homo sapiens inactivating mutations associated with campomelic dysplasia and autosomal XY se protein. Length = 509 Score = 33.1 bits (72), Expect = 0.93 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 411 NQRTILTTVTVLPLHLQEFNQHLPRRLVHPEWSLPPLNSSY 533 +QRT + T + P H E QH P+++ + ++LP + SY Sbjct: 392 SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSY 432 >BT006875-1|AAP35521.1| 509|Homo sapiens SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-rever protein. Length = 509 Score = 33.1 bits (72), Expect = 0.93 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 411 NQRTILTTVTVLPLHLQEFNQHLPRRLVHPEWSLPPLNSSY 533 +QRT + T + P H E QH P+++ + ++LP + SY Sbjct: 392 SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSY 432 >BC056420-1|AAH56420.1| 509|Homo sapiens SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-rever protein. Length = 509 Score = 33.1 bits (72), Expect = 0.93 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 411 NQRTILTTVTVLPLHLQEFNQHLPRRLVHPEWSLPPLNSSY 533 +QRT + T + P H E QH P+++ + ++LP + SY Sbjct: 392 SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSY 432 >BC007951-1|AAH07951.1| 509|Homo sapiens SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-rever protein. Length = 509 Score = 33.1 bits (72), Expect = 0.93 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 411 NQRTILTTVTVLPLHLQEFNQHLPRRLVHPEWSLPPLNSSY 533 +QRT + T + P H E QH P+++ + ++LP + SY Sbjct: 392 SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSY 432 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,906,885 Number of Sequences: 237096 Number of extensions: 2017445 Number of successful extensions: 5170 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5170 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7647512560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -