BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0405 (720 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12991| Best HMM Match : TP2 (HMM E-Value=1.4) 29 3.8 SB_28794| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_12991| Best HMM Match : TP2 (HMM E-Value=1.4) Length = 296 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -3 Query: 121 WYFIYYYIYNRKHLLTTCVHFPTFCIYYSLFFY*YLR 11 +Y+ YYY Y + H+ + YY ++Y Y R Sbjct: 260 YYYYYYYYYYYYYYYYYYYHYYYYYYYYYYYYYYYCR 296 >SB_28794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 27.9 bits (59), Expect = 8.8 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 121 WYFIYYYIYNRKHLLTTCVHFPTFCIYYSLFFY*Y 17 +Y+ YYY Y H ++ + YY ++Y Y Sbjct: 120 YYYYYYYYYYYHHYYYYYYYYYYYYYYYYYYYYYY 154 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,393,654 Number of Sequences: 59808 Number of extensions: 314913 Number of successful extensions: 509 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 499 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -