BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0403 (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 24 1.4 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 1.9 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 1.9 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 402 IWSTSLRSAATLLTIANSLSRPFSK 476 I+S L + TLL I +S+ RP+ K Sbjct: 25 IYSFLLLTTLTLLVILSSIDRPYLK 49 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 23.4 bits (48), Expect = 1.9 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -2 Query: 469 NGRDKLFAI-VNNVAAERRLVDQIHICLIHNHCIEQYVVFVKNALV 335 +G D A+ V V E + + IC IH E Y +F K L+ Sbjct: 248 SGLDSFMALTVMQVLKEMAMTGKTVICTIHQPSSEVYSMFDKLLLM 293 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.4 bits (48), Expect = 1.9 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -2 Query: 469 NGRDKLFAI-VNNVAAERRLVDQIHICLIHNHCIEQYVVFVKNALV 335 +G D A+ V V E + + IC IH E Y +F K L+ Sbjct: 248 SGLDSFMALTVMQVLKEMAMTGKTVICTIHQPSSEVYSMFDKLLLM 293 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,651 Number of Sequences: 336 Number of extensions: 3484 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -