BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0403 (728 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_7052| Best HMM Match : LRR_1 (HMM E-Value=2e-12) 28 8.9 >SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3408 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +2 Query: 173 YVSADTDADEPIIYFENITECLTDDQCDKFTYFA 274 YV+ D D I YF N E + DQ KF FA Sbjct: 3294 YVAGIKDTDLHIEYFWNALENFSQDQLRKFIKFA 3327 >SB_7052| Best HMM Match : LRR_1 (HMM E-Value=2e-12) Length = 1328 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 460 DKLFAIVNNVAAERRLVDQIHICLIH 383 ++LF I+ N ++ RRLVD CL H Sbjct: 558 ERLFFILENFSSNRRLVDLASQCLWH 583 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,093,383 Number of Sequences: 59808 Number of extensions: 424968 Number of successful extensions: 1030 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 965 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1030 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -