BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0403 (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280613-1|AAQ21366.1| 257|Anopheles gambiae carbonic anhydrase... 30 0.084 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 25 2.4 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 25 3.2 L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 24 4.2 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 24 4.2 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 24 4.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 7.3 >AY280613-1|AAQ21366.1| 257|Anopheles gambiae carbonic anhydrase alternate isoform protein. Length = 257 Score = 29.9 bits (64), Expect = 0.084 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = -3 Query: 363 TWCLLKTPSFLSTKCLYTFFINKACSCLSSAK*VN 259 TW + KTP ++S+K L F +AC SS K VN Sbjct: 195 TWLVYKTPIYVSSKQLEAFRQLQACPKDSSKKIVN 229 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 25.0 bits (52), Expect = 2.4 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = -2 Query: 433 VAAERRLVDQIHICLIHNHCIEQYVVFVKNALVFKHQ 323 + AERR++ ++ C+ H + V+++K + KHQ Sbjct: 177 IKAERRVLKELGFCVHVKHPHKLIVMYLKYLELEKHQ 213 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 24.6 bits (51), Expect = 3.2 Identities = 13/55 (23%), Positives = 24/55 (43%) Frame = -2 Query: 493 TAERKNFENGRDKLFAIVNNVAAERRLVDQIHICLIHNHCIEQYVVFVKNALVFK 329 TA + E + L A + ++ A QIH+C+ +E +F+ + K Sbjct: 191 TARVRELEARLEALEAQLQSMRAREEFQQQIHVCMARKAWLEYEELFLLYSATLK 245 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +3 Query: 426 AATLLTIANSLSRPFSKFLRSAVKSLWPCPS 518 A + T + +S PF R + WPC S Sbjct: 219 AQVVTTASGIISYPFDTVRRRMMMQSWPCKS 249 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +3 Query: 426 AATLLTIANSLSRPFSKFLRSAVKSLWPCPS 518 A + T + +S PF R + WPC S Sbjct: 219 AQVVTTASGIISYPFDTVRRRMMMQSWPCKS 249 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +2 Query: 476 IFTLSSKIVVA-VPVNWENDNLSVL 547 I+ L + VA V +NW DNL ++ Sbjct: 314 IYALEGSVAVAGVAMNWLRDNLKII 338 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.4 bits (48), Expect = 7.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 372 SNNTWCLLKTPSFLSTKC 319 S N W L+ SFL+T C Sbjct: 2313 SKNIWDALREKSFLTTDC 2330 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 726,420 Number of Sequences: 2352 Number of extensions: 13974 Number of successful extensions: 26 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -