BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0400 (493 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9XXW0 Cluster: Endonuclease and reverse transcriptase-... 126 3e-28 UniRef50_Q4W4D1 Cluster: Reverse transcriptase-like; n=1; Anther... 54 2e-06 UniRef50_Q28RA2 Cluster: ComEC/Rec2-related protein; n=2; Rhodob... 36 0.49 UniRef50_UPI0000519CB3 Cluster: PREDICTED: similar to CG5859-PA;... 35 1.1 UniRef50_UPI00005A9609 Cluster: PREDICTED: similar to USP6 N-ter... 33 4.6 UniRef50_Q640I9 Cluster: JmjC domain-containing histone demethyl... 33 4.6 UniRef50_A4R323 Cluster: Predicted protein; n=1; Magnaporthe gri... 32 6.0 UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 32 8.0 >UniRef50_Q9XXW0 Cluster: Endonuclease and reverse transcriptase-like protein; n=9; cellular organisms|Rep: Endonuclease and reverse transcriptase-like protein - Bombyx mori (Silk moth) Length = 960 Score = 126 bits (304), Expect = 3e-28 Identities = 57/59 (96%), Positives = 57/59 (96%) Frame = +3 Query: 6 SERYFDKAMRHDNRLIVAAADYSPNPDHAGASHRRRPRHVLTDPSDPITFALDAFSSNT 182 SERYFDKAMRHDNRLIVAAADYSPNPDHAGASHRRRPRHVLTDPSDPIT ALD FSSNT Sbjct: 880 SERYFDKAMRHDNRLIVAAADYSPNPDHAGASHRRRPRHVLTDPSDPITLALDTFSSNT 938 >UniRef50_Q4W4D1 Cluster: Reverse transcriptase-like; n=1; Antheraea mylitta|Rep: Reverse transcriptase-like - Antheraea mylitta (Tasar silkworm) Length = 186 Score = 53.6 bits (123), Expect = 2e-06 Identities = 25/52 (48%), Positives = 33/52 (63%) Frame = +3 Query: 15 YFDKAMRHDNRLIVAAADYSPNPDHAGASHRRRPRHVLTDPSDPITFALDAF 170 YF+KA H + L+V+AA+Y P P+ A RRRPRH+ DP D IT D + Sbjct: 94 YFEKAANHPSPLVVSAANYQPVPN--AARPRRRPRHIFIDPPDEITAVNDQY 143 >UniRef50_Q28RA2 Cluster: ComEC/Rec2-related protein; n=2; Rhodobacteraceae|Rep: ComEC/Rec2-related protein - Jannaschia sp. (strain CCS1) Length = 706 Score = 35.9 bits (79), Expect = 0.49 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = -1 Query: 457 PEGLSSFTRTGGRAKAQPRGVGFANNCPSASEGDLTTQE 341 P GL T GRA ++PRG GF ++GDL TQE Sbjct: 540 PGGLVGLTTDQGRALSRPRGDGFVAGIWLENDGDLITQE 578 >UniRef50_UPI0000519CB3 Cluster: PREDICTED: similar to CG5859-PA; n=1; Apis mellifera|Rep: PREDICTED: similar to CG5859-PA - Apis mellifera Length = 986 Score = 34.7 bits (76), Expect = 1.1 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = -2 Query: 417 QRLSQEGWDLLTTARAPPKET*QLKSNCFANESTTGSESR 298 ++ S+E WD++ TA P ++ Q +SN + ++TGS SR Sbjct: 697 RKFSREAWDMVLTAFGPSRDQPQKRSNSGNSGTSTGSASR 736 >UniRef50_UPI00005A9609 Cluster: PREDICTED: similar to USP6 N-terminal like protein (Related to the N terminus of tre) (RN-tre), partial; n=1; Canis lupus familiaris|Rep: PREDICTED: similar to USP6 N-terminal like protein (Related to the N terminus of tre) (RN-tre), partial - Canis familiaris Length = 386 Score = 32.7 bits (71), Expect = 4.6 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -2 Query: 342 SNCFANESTTGSESRPAEKIRRETQRVDAWVRL 244 S C ++ G R A+K+R+ET R D W+++ Sbjct: 27 SPCAGDKELPGPSPREAKKLRQETWRADKWIKM 59 >UniRef50_Q640I9 Cluster: JmjC domain-containing histone demethylation protein 1B; n=5; Xenopus|Rep: JmjC domain-containing histone demethylation protein 1B - Xenopus laevis (African clawed frog) Length = 1259 Score = 32.7 bits (71), Expect = 4.6 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = -2 Query: 417 QRLSQEGWDLLTTARAPPKET*QLKSNC-FANESTTGSESRPAEKIRRE 274 +R+ QE D LT A KE+ Q +S+ A ST GSE + +KIRR+ Sbjct: 812 RRIKQEPDDDLTEAAPKAKESDQSRSSSPTAGPSTEGSEPKEKKKIRRK 860 >UniRef50_A4R323 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 209 Score = 32.3 bits (70), Expect = 6.0 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +1 Query: 7 RNDTSIRLCVMIIASSLPPLTTPRILIMQEP 99 R D S+ CVM IAS L P TP L +EP Sbjct: 72 RTDRSLDACVMFIASLLLPRKTPTELYREEP 102 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 31.9 bits (69), Expect = 8.0 Identities = 23/71 (32%), Positives = 28/71 (39%) Frame = +3 Query: 81 PDHAGASHRRRPRHVLTDPSDPITFALDAFSSNTXXXXXXXXXXXXXXXXXXXXXX*PMH 260 P RR P HVL+DP D ++ LD S+ P Sbjct: 26 PRDGATKSRRHPNHVLSDPRDSLSVLLDLSSTGYCPCRVRRATN-------------PKT 72 Query: 261 QPAEFLAGSSQ 293 QP +FLAGSSQ Sbjct: 73 QPMKFLAGSSQ 83 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 461,504,599 Number of Sequences: 1657284 Number of extensions: 8565707 Number of successful extensions: 24150 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 23487 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24145 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 28437262108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -