BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0399 (637 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.6 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 1.6 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 23 1.6 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 3.7 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 6.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 330 SVSWSIDCDLVTPKKCHELFPML 398 +V+W+ID D + + C FP+L Sbjct: 962 AVAWTIDLDDFSNRCCGGSFPLL 984 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.4 bits (48), Expect = 1.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 475 RDIQSKCGSPTPSPGIHRP 419 R I+++C PT +HRP Sbjct: 83 RSIKNECPEPTCDEPVHRP 101 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 414 LGGLWIPGDGVGDPHLLCM 470 LG WIP GV L CM Sbjct: 45 LGSQWIPDLGVPIGVLYCM 63 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 23.4 bits (48), Expect = 1.6 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 568 PLPDTLSSFDSTAVTEQSSITPTPLSVASLIRDIQSKCGSPT 443 P+P +S S+A S +P P SV L ++ +C PT Sbjct: 201 PIPQRTASTASSASNYSPSQSPEPESVRPLSLVVR-RCEEPT 241 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 451 SPTPSPGIHRPPSTSS 404 S TP P RPPST S Sbjct: 405 STTPRPEWARPPSTPS 420 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.4 bits (43), Expect = 6.5 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -2 Query: 294 LLFLPIIVNHIVSTLWAYHEPQAP 223 ++++ I++ LWA +PQ+P Sbjct: 271 VMYIACSTPFILAQLWATWDPQSP 294 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,106 Number of Sequences: 336 Number of extensions: 3518 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -