BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0395 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 1.8 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 7.3 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 9.7 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 23.4 bits (48), Expect = 1.8 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -2 Query: 271 IITKNFFVLKFQLKTSNC*C*YRMKRTF-NSKDKCRVLSEISSRSINGTF 125 II K F ++ QLK S C ++ F +++ K R S+ +S +N F Sbjct: 200 IIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYF 249 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 346 HPSICKLILIMSLARCRYLSN 408 HPS+ L M A+C LSN Sbjct: 29 HPSLRGTPLAMLAAQCNKLSN 49 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 83 PLVSPHG*VPPP 48 P V PH VPPP Sbjct: 12 PTVLPHQEVPPP 23 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,846 Number of Sequences: 336 Number of extensions: 3823 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -