BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0395 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 24 4.0 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 24 4.0 AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 24 5.3 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 7.0 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 7.0 AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against p... 23 9.2 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 24.2 bits (50), Expect = 4.0 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -2 Query: 628 QLVLCKENCFALLRTPGRFECLFDITLELTSMLNAVDNIDP 506 +L++ +++ ALLR FECL ++TL+ L V + P Sbjct: 217 ELLVQEDSDVALLRI---FECLLEVTLQKILQLTIVLSTGP 254 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 24.2 bits (50), Expect = 4.0 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 20 HYCFTAEIGRVVVPTRADSQEVLP-PIK-RSYHQ*VPKSTVNGSGG 151 H F AEIG +V DS E+LP P + + PK GSGG Sbjct: 939 HIEFHAEIGMSLVLKVGDSSEMLPAPANFPTCYDFKPKLGQLGSGG 984 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 23.8 bits (49), Expect = 5.3 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 666 PSPEVGTVQHQRANLCFVKKTASLC*GLPGVLNAYLI 556 P VG + HQ L V ASLC G+P ++ + I Sbjct: 161 PLEGVGQICHQHDCLLIVDAVASLC-GVPFYMDKWEI 196 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 51 WWYLPVRTHKRSYHQ*RGPTTSKY 122 W+ LP + SYHQ + P S++ Sbjct: 160 WYQLPQQQQPSSYHQQQHPGHSQH 183 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -3 Query: 522 LTISTPSIPIPTEGCRVNHSDGMTSRSLCGGN 427 +T +TP P + S +S SLCGGN Sbjct: 784 VTSTTPPTPASLSSSS-SSSSSASSTSLCGGN 814 >AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against programmed cell death protein. Length = 112 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 431 VTIVEHKIFDRYLHRANDIIKI 366 +T V HK +D Y H+ +KI Sbjct: 4 LTEVLHKFYDEYTHKTPKKLKI 25 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 769,917 Number of Sequences: 2352 Number of extensions: 15675 Number of successful extensions: 37 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -