BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0395 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 24 1.2 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 2.8 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +3 Query: 363 ANLDNVVSAMQISVKYLVFYDSYRHIMIVTSFRRCD 470 A NVV ++ + L+FY S M + CD Sbjct: 8 AAFQNVVLVKKVKIVLLIFYGSIMFSMTQVNKEECD 43 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +3 Query: 555 ISNKHSKRPGVLNRAKQFSLQSTSWPSDAAL 647 I N H+ ++ ++Q QS WPS + + Sbjct: 566 IQNLHAGENTIIRNSQQAPGQSPDWPSTSQI 596 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,313 Number of Sequences: 438 Number of extensions: 4771 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -