BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0394 (429 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8A424 Cluster: Putative uncharacterized protein; n=1; ... 35 0.62 UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ... 33 1.9 >UniRef50_Q8A424 Cluster: Putative uncharacterized protein; n=1; Bacteroides thetaiotaomicron|Rep: Putative uncharacterized protein - Bacteroides thetaiotaomicron Length = 395 Score = 35.1 bits (77), Expect = 0.62 Identities = 24/82 (29%), Positives = 39/82 (47%) Frame = -2 Query: 392 PRESITIIALCGEYMIANNRLSVQSMKYFDVL*KYTTREEGYLKLSLIRYNYILTAGRRP 213 P E + + AL G +IA RLS +++ V+ E G + +LI +Y++ A Sbjct: 117 PGEILVLYALLGYVLIAVCRLSTRTVTIIAVILLLQPIELGQIIYALINPDYVINADLDA 176 Query: 212 YYVVLGINARQTRHFIEQCSRA 147 Y L A++ F+E C A Sbjct: 177 PYWELVNTAQKEGSFLEMCKTA 198 >UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 275 Score = 33.5 bits (73), Expect = 1.9 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 388 RGGARYPIRPIVSR 429 RGGARYPIRPIVSR Sbjct: 260 RGGARYPIRPIVSR 273 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 392,395,003 Number of Sequences: 1657284 Number of extensions: 7008975 Number of successful extensions: 13926 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13924 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 20653970351 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -