BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0394 (429 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 5.0 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 21 5.0 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 5.0 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 21 6.6 AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory recept... 21 6.6 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.0 bits (42), Expect = 5.0 Identities = 9/38 (23%), Positives = 18/38 (47%) Frame = -2 Query: 200 LGINARQTRHFIEQCSRAHVYYNNTRFAEKRPEHQSNY 87 +G+ ++H + Y ++ A++ P H SNY Sbjct: 5 VGMYGHHSQHGTYPSDNYYNYTSDIPNAQQMPPHYSNY 42 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 21.0 bits (42), Expect = 5.0 Identities = 9/38 (23%), Positives = 18/38 (47%) Frame = -2 Query: 200 LGINARQTRHFIEQCSRAHVYYNNTRFAEKRPEHQSNY 87 +G+ ++H + Y ++ A++ P H SNY Sbjct: 5 VGMYGHHSQHGTYPSDNYYNYTSDIPNAQQMPPHYSNY 42 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.0 bits (42), Expect = 5.0 Identities = 9/38 (23%), Positives = 18/38 (47%) Frame = -2 Query: 200 LGINARQTRHFIEQCSRAHVYYNNTRFAEKRPEHQSNY 87 +G+ ++H + Y ++ A++ P H SNY Sbjct: 5 VGMYGHHSQHGTYPSDNYYNYTSDIPNAQQMPPHYSNY 42 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 20.6 bits (41), Expect = 6.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 273 FFSGGIFLKNVKILHTLNG 329 F + G FL N +LHT+ G Sbjct: 344 FSACGFFLINGTLLHTIVG 362 >AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory receptor candidate 25 protein. Length = 314 Score = 20.6 bits (41), Expect = 6.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 273 FFSGGIFLKNVKILHTLNG 329 F + G FL N +LHT+ G Sbjct: 169 FSACGFFLINGTLLHTIVG 187 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,149 Number of Sequences: 336 Number of extensions: 1923 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9460170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -