BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0394 (429 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_01_0033 + 546670-546885,547497-547637,548025-548291 28 2.8 10_08_0867 + 21159931-21160075,21160288-21160409,21160539-211606... 28 3.7 >09_01_0033 + 546670-546885,547497-547637,548025-548291 Length = 207 Score = 28.3 bits (60), Expect = 2.8 Identities = 14/54 (25%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = -2 Query: 395 PPRESITIIALCGEYMIANNRLSVQ--SMKYFDVL*KYTTREEGYLKLSLIRYN 240 PP + + LCGE ++A +R+SV + + T R++G++++ L ++ Sbjct: 115 PPTNKTSSLRLCGERVVATSRVSVDPAARSGASDVSYPTERDDGWMEVKLAEFS 168 >10_08_0867 + 21159931-21160075,21160288-21160409,21160539-21160660, 21160775-21160879,21160967-21161057,21161154-21161297, 21161415-21161783,21161902-21162099 Length = 431 Score = 27.9 bits (59), Expect = 3.7 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 Query: 127 RDLRKNDQNINQTTQFETLYQNLI 56 RDL KNDQN Q E + NLI Sbjct: 279 RDLPKNDQNTTMEEQKEVISDNLI 302 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,356,989 Number of Sequences: 37544 Number of extensions: 182261 Number of successful extensions: 313 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 313 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 802495716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -