BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0394 (429 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-6|CAJ14157.1| 375|Anopheles gambiae RrnaAD, ribosomal ... 23 6.1 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 22 8.0 >CR954257-6|CAJ14157.1| 375|Anopheles gambiae RrnaAD, ribosomal RNA adenine dimethylaseprotein. Length = 375 Score = 22.6 bits (46), Expect = 6.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 336 VICDHIFSA*SDNGYRLSRGGPVPNSPYSE 425 ++ HI S D GY+L RGG + Y E Sbjct: 141 LLFSHIAST-KDAGYKLYRGGTIVFQLYFE 169 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 22.2 bits (45), Expect = 8.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 120 CGKTTRTSIKLHNLKRYIRT 61 C + S++L LKR+IRT Sbjct: 214 CTECDYASVELSKLKRHIRT 233 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 425,896 Number of Sequences: 2352 Number of extensions: 8810 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35292513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -