Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0394
         (429 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U80836-10|AAB37890.2|  306|Caenorhabditis elegans Hypothetical p...    28   3.3  

>U80836-10|AAB37890.2|  306|Caenorhabditis elegans Hypothetical
           protein B0432.4 protein.
          Length = 306

 Score = 27.9 bits (59), Expect = 3.3
 Identities = 19/64 (29%), Positives = 30/64 (46%)
 Frame = -2

Query: 326 VQSMKYFDVL*KYTTREEGYLKLSLIRYNYILTAGRRPYYVVLGINARQTRHFIEQCSRA 147
           +QSMK  D   +Y    + + K+      + L  G  PYY+ LG +   T   +EQ + A
Sbjct: 233 IQSMKVIDGKPEYKNAFDVWGKVIKNEGIFALWKGFTPYYMRLGPHTVLTFIILEQMNAA 292

Query: 146 HVYY 135
           +  Y
Sbjct: 293 YFQY 296


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,226,364
Number of Sequences: 27780
Number of extensions: 175284
Number of successful extensions: 331
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 328
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 331
length of database: 12,740,198
effective HSP length: 75
effective length of database: 10,656,698
effective search space used: 713998766
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)