BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0393 (525 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O97299 Cluster: Putative uncharacterized protein MAL3P7... 33 3.0 UniRef50_Q8E2E2 Cluster: Membrane protein, putative; n=5; Strept... 33 5.3 UniRef50_Q5UF72 Cluster: Putative lipid A biosynthesis lauroylac... 32 9.3 UniRef50_Q23C36 Cluster: Putative uncharacterized protein; n=1; ... 32 9.3 UniRef50_Q6KZF5 Cluster: Hypothetical membrane spanning protein;... 32 9.3 >UniRef50_O97299 Cluster: Putative uncharacterized protein MAL3P7.37; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein MAL3P7.37 - Plasmodium falciparum (isolate 3D7) Length = 1542 Score = 33.5 bits (73), Expect = 3.0 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +2 Query: 260 FNKNILKNIMILLFISFEILINNFRGLLSIYKTPLFLSVFFSHVNYHFV 406 FN N K+ I L+ + IL NN +I K L + FF +V Y F+ Sbjct: 1286 FNNNCCKDNNIYLYYPYSILCNNLDLNNNILKKHLLVEHFFKYVLYDFI 1334 >UniRef50_Q8E2E2 Cluster: Membrane protein, putative; n=5; Streptococcus agalactiae|Rep: Membrane protein, putative - Streptococcus agalactiae serotype V Length = 463 Score = 32.7 bits (71), Expect = 5.3 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = +2 Query: 272 ILKNIMILLFISFEILINNFRGLLSIYKTP-LFLSVFFS 385 +LK ++I LI N + LSI +TP LF+S+FF+ Sbjct: 249 LLKKLVIYFIFFIATLIGNLKNELSILETPLLFISIFFT 287 >UniRef50_Q5UF72 Cluster: Putative lipid A biosynthesis lauroylacyltransferase; n=1; uncultured proteobacterium RedeBAC7D11|Rep: Putative lipid A biosynthesis lauroylacyltransferase - uncultured proteobacterium RedeBAC7D11 Length = 307 Score = 31.9 bits (69), Expect = 9.3 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%) Frame = +2 Query: 263 NKNILKNIMILLFISFEILINNFRGLLSI--YKTPLFLSVFFSHVNYHFVN 409 NK I+K+I +F+ EIL+ F LLS+ +K +FL + Y F++ Sbjct: 2 NKQIVKSI---IFLKMEILLKTFLWLLSLIPFKVQMFLGKILGKILYKFLS 49 >UniRef50_Q23C36 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1524 Score = 31.9 bits (69), Expect = 9.3 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 2 NFENCSKCSRNCSFCS 49 N++ C KCS NC FC+ Sbjct: 815 NYQTCEKCSENCKFCT 830 >UniRef50_Q6KZF5 Cluster: Hypothetical membrane spanning protein; n=1; Picrophilus torridus|Rep: Hypothetical membrane spanning protein - Picrophilus torridus Length = 610 Score = 31.9 bits (69), Expect = 9.3 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Frame = +2 Query: 263 NKNILKNIMILLFISFEILINNFRGLLSIYKTPL-FLSVFFSHVNYHFVNVCR*DSRGTN 439 N+ I N + +LF +++ F G L+IY L LS+ S + + F++ +++ N Sbjct: 7 NERITVNEISILFFIIPLILFGFFGYLNIYAIILESLSIILSFI-FLFISNINIETKKIN 65 Query: 440 HESVFLFDIFFIL 478 +E +F+ F ++ Sbjct: 66 YEEIFIITGFIMV 78 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 430,179,810 Number of Sequences: 1657284 Number of extensions: 7268700 Number of successful extensions: 21305 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21298 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 33037407449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -