BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0388 (713 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 105 3e-23 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 105 3e-23 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 105 3e-23 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 5e-19 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 8e-18 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 87 1e-17 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 85 4e-17 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 82 4e-16 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 76 2e-14 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 4e-14 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 64 8e-11 SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) 64 8e-11 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 62 4e-10 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_28080| Best HMM Match : Glycolytic (HMM E-Value=0) 60 2e-09 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_40748| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_30809| Best HMM Match : Mab-21 (HMM E-Value=0) 58 7e-09 SB_29937| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_39908| Best HMM Match : Prismane (HMM E-Value=3) 58 9e-09 SB_3548| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29561| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_19262| Best HMM Match : Laminin_EGF (HMM E-Value=0.36) 56 2e-08 SB_14096| Best HMM Match : DUF595 (HMM E-Value=2.1) 56 2e-08 SB_3195| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_48874| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 56 3e-08 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) 56 3e-08 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_55190| Best HMM Match : UCR_TM (HMM E-Value=8.9) 56 3e-08 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_47281| Best HMM Match : Adaptin_N (HMM E-Value=0) 56 3e-08 SB_25859| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_17772| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_2380| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_43774| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.21) 56 4e-08 SB_28437| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_20950| Best HMM Match : PHD (HMM E-Value=0.2) 56 4e-08 SB_17408| Best HMM Match : I-set (HMM E-Value=7.4e-06) 56 4e-08 SB_3686| Best HMM Match : Myotub-related (HMM E-Value=2.8e-08) 56 4e-08 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) 55 5e-08 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 55 5e-08 SB_51573| Best HMM Match : UCR_TM (HMM E-Value=6.7) 55 5e-08 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_24420| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_21827| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 55 5e-08 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 55 7e-08 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_27671| Best HMM Match : UCR_TM (HMM E-Value=0.82) 55 7e-08 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 55 7e-08 SB_18129| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_51819| Best HMM Match : TGF_beta (HMM E-Value=1.9) 55 7e-08 SB_40757| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_31018| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_26019| Best HMM Match : F5_F8_type_C (HMM E-Value=2.6e-29) 55 7e-08 SB_17057| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_15776| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_13740| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) 54 9e-08 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 54 9e-08 SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58562| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 54 9e-08 SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 54 9e-08 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 54 9e-08 SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 54 9e-08 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 54 9e-08 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 54 9e-08 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 54 9e-08 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 54 9e-08 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 54 9e-08 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 54 9e-08 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 54 9e-08 SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 54 9e-08 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 54 9e-08 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 54 9e-08 SB_54117| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_54092| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 54 9e-08 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_53629| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_53123| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 54 9e-08 SB_52872| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) 54 9e-08 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 54 9e-08 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 54 9e-08 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 54 9e-08 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 54 9e-08 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 54 9e-08 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_51754| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 54 9e-08 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_51567| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 54 9e-08 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_51356| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_51272| Best HMM Match : SMC_hinge (HMM E-Value=6.3) 54 9e-08 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 54 9e-08 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_51070| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 54 9e-08 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50749| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 54 9e-08 SB_50634| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50512| Best HMM Match : Kelch_1 (HMM E-Value=0.17) 54 9e-08 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50488| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50482| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_50012| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49975| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49917| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) 54 9e-08 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49761| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49678| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49547| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49509| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49332| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 54 9e-08 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 54 9e-08 SB_48922| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48921| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48840| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48531| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48210| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 54 9e-08 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 54 9e-08 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_47936| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_47873| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 54 9e-08 SB_47650| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 54 9e-08 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 54 9e-08 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_47060| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46943| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46899| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 54 9e-08 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46559| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 54 9e-08 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 54 9e-08 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 54 9e-08 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46255| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46237| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46156| Best HMM Match : RNA_pol_delta (HMM E-Value=8.9) 54 9e-08 SB_46079| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45828| Best HMM Match : S-antigen (HMM E-Value=0.0095) 54 9e-08 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45770| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45428| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45376| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45360| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45235| Best HMM Match : CBM_20 (HMM E-Value=0.91) 54 9e-08 SB_45128| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44882| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 54 9e-08 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 54 9e-08 SB_44716| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44551| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44440| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 54 9e-08 SB_44121| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 54 9e-08 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_43812| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 54 9e-08 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 54 9e-08 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_43415| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 54 9e-08 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 54 9e-08 SB_43116| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 54 9e-08 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 54 9e-08 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 54 9e-08 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42166| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42148| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 54 9e-08 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41652| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41597| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41534| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41390| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 54 9e-08 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40755| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40671| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40647| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40555| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40354| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 105 bits (253), Expect = 3e-23 Identities = 51/62 (82%), Positives = 53/62 (85%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNARGFPSHDVVKRRPVNCNTTHYRA 508 PFRLRNCWEGRSVRA SLLRQLAK G C A +L + GFPSHDVVKRRPVNCNTTHYRA Sbjct: 591 PFRLRNCWEGRSVRASSLLRQLAKGG--CAARRL--SWGFPSHDVVKRRPVNCNTTHYRA 646 Query: 507 NW 502 NW Sbjct: 647 NW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 105 bits (253), Expect = 3e-23 Identities = 51/62 (82%), Positives = 53/62 (85%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNARGFPSHDVVKRRPVNCNTTHYRA 508 PFRLRNCWEGRSVRA SLLRQLAK G C A +L + GFPSHDVVKRRPVNCNTTHYRA Sbjct: 34 PFRLRNCWEGRSVRASSLLRQLAKGG--CAARRL--SWGFPSHDVVKRRPVNCNTTHYRA 89 Query: 507 NW 502 NW Sbjct: 90 NW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 105 bits (253), Expect = 3e-23 Identities = 51/62 (82%), Positives = 53/62 (85%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNARGFPSHDVVKRRPVNCNTTHYRA 508 PFRLRNCWEGRSVRA SLLRQLAK G C A +L + GFPSHDVVKRRPVNCNTTHYRA Sbjct: 34 PFRLRNCWEGRSVRASSLLRQLAKGG--CAARRL--SWGFPSHDVVKRRPVNCNTTHYRA 89 Query: 507 NW 502 NW Sbjct: 90 NW 91 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 98.7 bits (235), Expect = 4e-21 Identities = 48/61 (78%), Positives = 50/61 (81%), Gaps = 1/61 (1%) Frame = -3 Query: 681 RLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNAR-GFPSHDVVKRRPVNCNTTHYRAN 505 +LRNCWEGRSVRA SLLRQLAK G C A +L GFPSHDVVKRRPVNCNTTHYRAN Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGG--CAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRAN 79 Query: 504 W 502 W Sbjct: 80 W 80 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 91.9 bits (218), Expect = 5e-19 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -3 Query: 618 KRGMCCKAIKLGNARGFPSHDVVKRRPVNCNTTHYRANW 502 +RGMCCKAIKLGNA+GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 21 ERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 34.7 bits (76), Expect = 0.075 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -1 Query: 677 CATVGKGDRCGPFRYYASWRKGGC 606 CATVGKGDRCG F + +G C Sbjct: 2 CATVGKGDRCGLFAITPAGERGMC 25 Score = 31.1 bits (67), Expect = 0.93 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -2 Query: 667 LGRAIGAGLFAITPAGEKGDVLQGD*VG*RQGF 569 +G+ GLFAITPAGE+G + +G +GF Sbjct: 5 VGKGDRCGLFAITPAGERGMCCKAIKLGNAKGF 37 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 87.8 bits (208), Expect = 8e-18 Identities = 39/54 (72%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = -3 Query: 660 GRSVRA-FSLLRQLAKRGMCCKAIKLGNARGFPSHDVVKRRPVNCNTTHYRANW 502 GR++ A + +RGMCCKAIKLGNA FPSHDVVKRRPVNCNTTHYRANW Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 Score = 51.6 bits (118), Expect = 6e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 685 IQAAQLLGRAIGAGLFAITPAGEKG 611 IQAAQLLGRAIGAGLFAITPAGE+G Sbjct: 7 IQAAQLLGRAIGAGLFAITPAGERG 31 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 87.0 bits (206), Expect = 1e-17 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 618 KRGMCCKAIKLGNARGFPSHDVVKRRPVNCNTTHYRANW 502 +RGMCCKAIKLGNA FPSHDVVKRRPVNCNTTHYRANW Sbjct: 15 ERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 Score = 35.1 bits (77), Expect = 0.057 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -2 Query: 658 AIGAGLFAITPAGEKG 611 AIGAGLFAITPAGE+G Sbjct: 2 AIGAGLFAITPAGERG 17 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 85.4 bits (202), Expect = 4e-17 Identities = 39/53 (73%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = -3 Query: 660 GRSVRA-FSLLRQLAKRGMCCKAIKLGNARGFPSHDVVKRRPVNCNTTHYRAN 505 GRS+ A + +RGMCCKAIKLGNARGFPSHD KRRPVNCNTTHYRAN Sbjct: 45 GRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -2 Query: 682 QAAQLLGRAIGAGLFAITPAGEKGDVLQGD*VG*RQGF 569 + AQLLGR+IGAGLFAITPAGE+G + +G +GF Sbjct: 39 RVAQLLGRSIGAGLFAITPAGERGMCCKAIKLGNARGF 76 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 82.2 bits (194), Expect = 4e-16 Identities = 36/54 (66%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = -3 Query: 660 GRSVRA-FSLLRQLAKRGMCCKAIKLGNARGFPSHDVVKRRPVNCNTTHYRANW 502 GR++ A + +RGMCCK+IKL +A FPSHDVVKRRPVNCNTTHYRANW Sbjct: 8 GRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 685 IQAAQLLGRAIGAGLFAITPAGEKG 611 +QAAQLLGRAIGAGLFAITPAGE+G Sbjct: 1 MQAAQLLGRAIGAGLFAITPAGERG 25 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 82.2 bits (194), Expect = 4e-16 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -3 Query: 624 LAKRGMCCKAIKLGNARGFPSHDVVKRRPVNCNTTHYRAN 505 LA+RGMCCKAIKLGNA F SHDVVKRRPVNCNTTHYRAN Sbjct: 1 LAERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 81.8 bits (193), Expect = 5e-16 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK LALPNLIALQHIP FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 17 GKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSLNG 57 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = +1 Query: 520 SRITIHWPSFYNVVTGKTPGVTQLNRLAAHPPF 618 SRITIHWPSFYNVVTGKT + L L PPF Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPF 34 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 77.0 bits (181), Expect = 1e-14 Identities = 40/51 (78%), Positives = 42/51 (82%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNARGFPSHDVVKRRPV 535 PFRLRNCWEGRSVRA SLLRQLAK G C A +L + GFPSHDVVKRRPV Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGG--CAARRL--SWGFPSHDVVKRRPV 67 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 76.2 bits (179), Expect = 2e-14 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +1 Query: 502 PIRPIVSRITIHWPSFYNVVTGKTPGVTQLNRLAAHPPF 618 PIRPIVSRITIHWP+FYN TGKT TQLNRLAAHPPF Sbjct: 39 PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPF 77 Score = 56.8 bits (131), Expect = 2e-08 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK LA L L P FASWRNS++AR DRPSQQLRSLNG Sbjct: 60 GKTLAYTQLNRLAAHPPFASWRNSQEARADRPSQQLRSLNG 100 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 75.8 bits (178), Expect = 3e-14 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -3 Query: 660 GRSVRA-FSLLRQLAKRGMCCKAIKLGNARGFPSHDVVKRRPVNCNTTHYRANW 502 GR++ A + +RGMCCKAIKL FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1847 GRAIGAGLFAITPAGERGMCCKAIKLVTPV-FPSHDVVKRRPVNCNTTHYRANW 1899 Score = 51.6 bits (118), Expect = 6e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 685 IQAAQLLGRAIGAGLFAITPAGEKG 611 IQAAQLLGRAIGAGLFAITPAGE+G Sbjct: 1840 IQAAQLLGRAIGAGLFAITPAGERG 1864 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 75.4 bits (177), Expect = 4e-14 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 520 SRITIHWPSFYNVVTGKTPGVTQLNRLAAHPPF 618 SRITIHWPSFYNVVTGK PGVTQLNRLAAHPPF Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPF 34 Score = 56.0 bits (129), Expect = 3e-08 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 17 GKNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 57 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 72.9 bits (171), Expect = 2e-13 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK LALPNLIALQHIPL + RNSE+ARTDRPSQQLRSLNG Sbjct: 15 GKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNG 55 Score = 36.3 bits (80), Expect = 0.025 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +1 Query: 535 HWPSFYNVVTGKTPGVTQLNRLAAHP 612 HWPSFYNVVTGKT + L L P Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIP 30 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 72.9 bits (171), Expect = 2e-13 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK LALPNLIALQ P FASWRNSE+ARTDRPSQ+LRSLNG Sbjct: 17 GKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNG 57 Score = 55.2 bits (127), Expect = 5e-08 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +1 Query: 520 SRITIHWPSFYNVVTGKTPGVTQLNRLAAHPPF 618 SRITIHWPSFYNVVTGKT + L L HPPF Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPF 34 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 72.5 bits (170), Expect = 3e-13 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK LALPNLIAL P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 17 GKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSLNG 57 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 520 SRITIHWPSFYNVVTGKTPGVTQLNRLAAHPPF 618 SRITIHWPSFYNVVTGKT + L LAAHPPF Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPF 34 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 520 SRITIHWPSFYNVVTGKTPGVTQLNRLAAHPPF 618 SRITIHWPSFYNVVTGK GVTQLNRLAAHPPF Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPF 34 Score = 56.8 bits (131), Expect = 2e-08 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 17 GKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 57 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 520 SRITIHWPSFYNVVTGKTPGVTQLNRLAAHPPF 618 SRITIHWPSFYNVVTGK GVTQLNRLAAHPPF Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPF 34 Score = 56.8 bits (131), Expect = 2e-08 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 17 GKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 57 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 71.7 bits (168), Expect = 5e-13 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 662 KGDRCGPFRYYASWRKGGCAARRLSWVTPG 573 +GDRCGP RYYASWRKGGCAARRLSWVTPG Sbjct: 67 QGDRCGPLRYYASWRKGGCAARRLSWVTPG 96 Score = 34.7 bits (76), Expect = 0.075 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 574 GFSQSRRCKTTASEL 530 GFSQSRRCKTTASEL Sbjct: 96 GFSQSRRCKTTASEL 110 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 71.3 bits (167), Expect = 7e-13 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 520 SRITIHWPSFYNVVTGKTPGVTQLNRLAAHPPF 618 SRITIHWPSFYNV+ KTPGVTQLNRLAAHPPF Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPF 34 Score = 57.2 bits (132), Expect = 1e-08 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +2 Query: 563 LGKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 L K + L L P FASWRNSEKARTDRPSQQLRSLNG Sbjct: 16 LAKTPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSLNG 57 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 70.9 bits (166), Expect = 9e-13 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 520 SRITIHWPSFYNVVTGKTPGVTQLNRLAAHPPF 618 SRITIHWPSFYNVVTGKT VTQLNRLAAHPPF Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPF 34 Score = 59.7 bits (138), Expect = 2e-09 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK L++ L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 17 GKTLSVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 57 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 70.9 bits (166), Expect = 9e-13 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 677 CATVGKGDRCGPFRYYASWRKGGCAARRLSWVTPG 573 CATVGKGDRCGP RYYASWRKG RLSWVTPG Sbjct: 2 CATVGKGDRCGPLRYYASWRKGDVLQGRLSWVTPG 36 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/46 (52%), Positives = 27/46 (58%) Frame = -2 Query: 667 LGRAIGAGLFAITPAGEKGDVLQGD*VG*RQGFSQSRRCKTTASEL 530 +G+ G + KGDVLQG GFSQSRRCKTTASEL Sbjct: 5 VGKGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 69.7 bits (163), Expect = 2e-12 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQ 670 GK LALPNLIALQHIP FASWRNS++ARTDRPSQQ Sbjct: 15 GKTLALPNLIALQHIPTFASWRNSQEARTDRPSQQ 49 Score = 35.5 bits (78), Expect = 0.043 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = +1 Query: 535 HWPSFYNVVTGKTPGVTQLNRLAAHPPF 618 HWPSFYN VTGKT + L L P F Sbjct: 5 HWPSFYNDVTGKTLALPNLIALQHIPTF 32 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK LALPNLIALQHIPL + NSE+ARTDRPSQQLRSLNG Sbjct: 17 GKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNG 57 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +1 Query: 520 SRITIHWPSFYNVVTGKTPGVTQLNRLAAHP 612 SRITIHWPSFYNVVTGKT + L L P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 69.7 bits (163), Expect = 2e-12 Identities = 29/36 (80%), Positives = 29/36 (80%) Frame = -1 Query: 680 GCATVGKGDRCGPFRYYASWRKGGCAARRLSWVTPG 573 GCATVGKGDRCGP RYYASWRKG A RLS TPG Sbjct: 30 GCATVGKGDRCGPLRYYASWRKGDATASRLSGATPG 65 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/51 (43%), Positives = 25/51 (49%) Frame = -2 Query: 682 QAAQLLGRAIGAGLFAITPAGEKGDVLQGD*VG*RQGFSQSRRCKTTASEL 530 Q +G+ G + KGD G GFSQSRRCKTTASEL Sbjct: 29 QGCATVGKGDRCGPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 69.7 bits (163), Expect = 2e-12 Identities = 36/41 (87%), Positives = 37/41 (90%), Gaps = 1/41 (2%) Frame = -2 Query: 688 PIQAAQLLGRAIGAGLFAITPAGEKGDVLQGD-*VG*RQGF 569 P QAAQLLGRAIGAGLFAITPAGEKGDVLQGD +G RQGF Sbjct: 40 PSQAAQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGF 80 Score = 68.5 bits (160), Expect = 5e-12 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 594 IKLGNARGFPSHDVVKRRPVNCNTTHYRANW 502 +KLG +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 72 LKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 69.3 bits (162), Expect = 3e-12 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKL 586 PFRLRNCWEGRSVRA SLLRQLAK G CCKAIKL Sbjct: 374 PFRLRNCWEGRSVRASSLLRQLAKGGCCCKAIKL 407 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 67.7 bits (158), Expect = 9e-12 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 520 SRITIHWPSFYNVVTGKTPGVTQLNRLAAHPPF 618 SRITIHWPSFYNVV + PGVTQLNRLAAHPPF Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPF 34 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 32 PPFASWRNSEEARTDRPSQQLRSLNG 57 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 67.7 bits (158), Expect = 9e-12 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK LALPNL L+HIPL+AS SE+ARTDRPSQQLRSLNG Sbjct: 17 GKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNG 57 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +1 Query: 520 SRITIHWPSFYNVVTGKTPGVTQL 591 SRITIHWPSFYNVVTGKT + L Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNL 25 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.7 bits (158), Expect = 9e-12 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = +1 Query: 505 IRPIVSRITIHWPSFYNVVTGKTPGVTQLNRLAAHPPF 618 IRPIVSRITIHWPSFY + PGV QLNRLAAHPPF Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPF 55 Score = 50.4 bits (115), Expect = 1e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWR+SE+ARTDRPSQQLR LNG Sbjct: 53 PPFASWRSSEEARTDRPSQQLRRLNG 78 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 66.5 bits (155), Expect = 2e-11 Identities = 36/62 (58%), Positives = 36/62 (58%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNARGFPSHDVVKRRPVNCNTTHYRA 508 PFRLRNCWEGRS GFPSHDVVKRRPVNCNTTHYRA Sbjct: 45 PFRLRNCWEGRS--------------------------GFPSHDVVKRRPVNCNTTHYRA 78 Query: 507 NW 502 NW Sbjct: 79 NW 80 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 66.1 bits (154), Expect = 3e-11 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK LALPNLIALQHIPL + + E+ARTDRPSQQLRSLNG Sbjct: 95 GKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNG 135 Score = 48.0 bits (109), Expect = 8e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +1 Query: 511 PIVSRITIHWPSFYNVVTGKTPGVTQLNRLAAHP 612 P +SRITIHWPSFYNVVTGKT + L L P Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIP 110 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 65.3 bits (152), Expect = 5e-11 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 668 VGKGDRCGPFRYYASWRKGGCAARRLSWVTPG 573 +GKGDRCGP RYYASWRKG RRLSWVTPG Sbjct: 5 LGKGDRCGPLRYYASWRKGDVLQRRLSWVTPG 36 Score = 48.0 bits (109), Expect = 8e-06 Identities = 28/50 (56%), Positives = 30/50 (60%) Frame = -2 Query: 679 AAQLLGRAIGAGLFAITPAGEKGDVLQGD*VG*RQGFSQSRRCKTTASEL 530 AAQLLG+ G + KGDVLQ GFSQSRRCKTTASEL Sbjct: 1 AAQLLGKGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 64.9 bits (151), Expect = 6e-11 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK LALPNLIALQHIPL + +E+ARTDRPSQQLRSLNG Sbjct: 53 GKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLNG 93 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = +1 Query: 505 IRPIVSRITIHWPSFYNVVTGKTPGVTQLNRLAAHP 612 +RP+VSRITIHW SFYNVVTGKT + L L P Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIP 68 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 64.5 bits (150), Expect = 8e-11 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +1 Query: 535 HWPSFYNVVTGKTPGVTQLNRLAAHPPF 618 HWPSFYNVVTGKT GVTQLNRLAAHPPF Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPF 32 Score = 59.3 bits (137), Expect = 3e-09 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK L + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 15 GKTLGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 55 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 64.5 bits (150), Expect = 8e-11 Identities = 30/43 (69%), Positives = 32/43 (74%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPFRQLA**RKGPHRSPFPTVAQPEWANG 696 + PGVTQLNRLAAHPPF + PHRSPFPTVAQPEW G Sbjct: 354 ENPGVTQLNRLAAHPPFASWRNSER-PHRSPFPTVAQPEWRMG 395 >SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) Length = 272 Score = 64.5 bits (150), Expect = 8e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 695 PFAHSGCATVGKGDRCGPFRYYASWRKG 612 P HSGCATVGKGDRCGP RYYASWRKG Sbjct: 239 PIRHSGCATVGKGDRCGPLRYYASWRKG 266 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 64.5 bits (150), Expect = 8e-11 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +2 Query: 584 PNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 P+L LQ+IPL ASWRNSE+ARTDRPSQQLRSLNG Sbjct: 24 PSLFDLQYIPLVASWRNSEEARTDRPSQQLRSLNG 58 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +1 Query: 520 SRITIHWPSFYNVVTGKTPG 579 SRITIHWPSFYNVVTGK G Sbjct: 2 SRITIHWPSFYNVVTGKNTG 21 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 62.1 bits (144), Expect = 4e-10 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 686 HSGCATVGKGDRCGPFRYYASWRKG 612 HSGCATVGKGDRCGP RYYASWRKG Sbjct: 88 HSGCATVGKGDRCGPLRYYASWRKG 112 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAI 592 PFRLRNCWEGRSVRA SLLRQLAK G + + Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 52 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 617 KGGCAARRLSWVTPG 573 KGGCAARRLSWVTPG Sbjct: 44 KGGCAARRLSWVTPG 58 Score = 31.1 bits (67), Expect = 0.93 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 574 GFSQSRRCKTTAS 536 GFSQSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 61.7 bits (143), Expect = 6e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 573 GFPSHDVVKRRPVNCNTTHYRANW 502 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 61.7 bits (143), Expect = 6e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +2 Query: 533 FTGRRFTTS*LGKPLALPNLIALQHIPLFASWRNS 637 +TGRRFTT GK LALPNLIALQHIP FASWRNS Sbjct: 54 WTGRRFTTLVTGKTLALPNLIALQHIPHFASWRNS 88 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 60.9 bits (141), Expect = 1e-09 Identities = 33/51 (64%), Positives = 35/51 (68%) Frame = +2 Query: 536 TGRRFTTS*LGKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 TGRRFT P + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 40 TGRRFTRRDWENP-GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 89 >SB_28080| Best HMM Match : Glycolytic (HMM E-Value=0) Length = 304 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +2 Query: 575 LALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 L PN++ H P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 226 LLKPNMVTAAHPP-FASWRNSEEARTDRPSQQLRSLNG 262 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 570 FPSHDVVKRRPVNCNTTHYRANW 502 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANW 59 >SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 58.4 bits (135), Expect = 5e-09 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKL 586 PFRLRNCWEGRSVR + +RGMCCKAIKL Sbjct: 45 PFRLRNCWEGRSVRGLFAITPAGERGMCCKAIKL 78 >SB_40748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 58.4 bits (135), Expect = 5e-09 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 G PL + ++ H P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 26 GIPLTAQSAYSIAHPP-FASWRNSEEARTDRPSQQLRSLNG 65 >SB_30809| Best HMM Match : Mab-21 (HMM E-Value=0) Length = 1710 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/43 (60%), Positives = 29/43 (67%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNARGFPSH 559 PFRLRNCWEGRSVRA SLLRQLAK G + + + P H Sbjct: 771 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWDILQNIPGH 813 >SB_29937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 58.0 bits (134), Expect = 7e-09 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = -1 Query: 695 PFAHSGCATVGKGDRCGPFRYYASWRKG 612 P HSGCA+VGKGDRCGP R Y+SWRKG Sbjct: 4 PIPHSGCASVGKGDRCGPLRSYSSWRKG 31 >SB_39908| Best HMM Match : Prismane (HMM E-Value=3) Length = 456 Score = 57.6 bits (133), Expect = 9e-09 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNARG 571 PFRLRNCWEGRSVRA SLLRQLAK G + + G G Sbjct: 323 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWGRESG 361 Score = 51.6 bits (118), Expect = 6e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 685 IQAAQLLGRAIGAGLFAITPAGEKG 611 IQAAQLLGRAIGAGLFAITPAGE+G Sbjct: 7 IQAAQLLGRAIGAGLFAITPAGERG 31 Score = 31.9 bits (69), Expect = 0.53 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 660 GRSVRA-FSLLRQLAKRGMCCKAIKLGNARG 571 GR++ A + +RGMCCKAIKL RG Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLAKLRG 44 >SB_3548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 683 SGCATVGKGDRCGPFRYYASWR 618 SGCATVGKGDRCGPFRYYASWR Sbjct: 53 SGCATVGKGDRCGPFRYYASWR 74 >SB_29561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 56.8 bits (131), Expect = 2e-08 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = +2 Query: 554 TS*LGKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 TS L K L + L+ P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 71 TSELTKDLTSDLMKDLRTHPPFASWRNSEEARTDRPSQQLRSLNG 115 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.4 bits (130), Expect = 2e-08 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 GK + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 17 GKTPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 57 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 550 YNVVTGKTPGVTQLNRLAAHPPF 618 YNVVTGKTPGVTQLNRLAAHPPF Sbjct: 12 YNVVTGKTPGVTQLNRLAAHPPF 34 >SB_19262| Best HMM Match : Laminin_EGF (HMM E-Value=0.36) Length = 1173 Score = 56.4 bits (130), Expect = 2e-08 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNA 577 PFRLRNCWEGRSVRA SLLRQLAK G + + N+ Sbjct: 74 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWANS 110 >SB_14096| Best HMM Match : DUF595 (HMM E-Value=2.1) Length = 233 Score = 56.4 bits (130), Expect = 2e-08 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNAR 574 PFRLRNCWEGRSVRA SLLRQLAK G C A +L AR Sbjct: 34 PFRLRNCWEGRSVRASSLLRQLAKGG--CAARRLSWAR 69 >SB_3195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 56.4 bits (130), Expect = 2e-08 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNARG 571 PFRLRNCWEGRSVRA SLLRQLAK G + + + +G Sbjct: 302 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWNDRQG 340 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 56.0 bits (129), Expect = 3e-08 Identities = 31/51 (60%), Positives = 33/51 (64%) Frame = +2 Query: 536 TGRRFTTS*LGKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 TGRR P + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 15 TGRRLQRRDWENP-GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 64 >SB_48874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 56.0 bits (129), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSEKARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEKARTDRPSQQLRSLNG 28 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 56.0 bits (129), Expect = 3e-08 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLG 583 PFRLRNCWEGRSVRA SLLRQLAK G + + G Sbjct: 406 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 440 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 1214 PPFASWRNSEEARTDRPSQQLRSLNG 1239 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 1200 ENPGVTQLNRLAAHPPF 1216 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 1190 LAVVLQRRDWENP 1202 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 56.0 bits (129), Expect = 3e-08 Identities = 31/51 (60%), Positives = 33/51 (64%) Frame = +2 Query: 536 TGRRFTTS*LGKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 TGRR P + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 35 TGRRLQRRDWENP-GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 84 >SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) Length = 912 Score = 56.0 bits (129), Expect = 3e-08 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLG 583 PFRLRNCWEGRSVRA SLLRQLAK G + + G Sbjct: 34 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 68 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 56.0 bits (129), Expect = 3e-08 Identities = 31/51 (60%), Positives = 33/51 (64%) Frame = +2 Query: 536 TGRRFTTS*LGKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 TGRR P + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 25 TGRRLQRRDWENP-GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 74 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 56.0 bits (129), Expect = 3e-08 Identities = 31/51 (60%), Positives = 33/51 (64%) Frame = +2 Query: 536 TGRRFTTS*LGKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 TGRR P + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 45 TGRRLQRRDWENP-GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 94 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 56.0 bits (129), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSEKARTDRPSQQLRSLNG Sbjct: 147 PPFASWRNSEKARTDRPSQQLRSLNG 172 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 133 ENPGVTQLNRLAAHPPF 149 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 123 LAVVLQRRDWENP 135 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 56.0 bits (129), Expect = 3e-08 Identities = 31/51 (60%), Positives = 33/51 (64%) Frame = +2 Query: 536 TGRRFTTS*LGKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 TGRR P + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 72 TGRRLQRRDWENP-GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 121 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 56.0 bits (129), Expect = 3e-08 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLG 583 PFRLRNCWEGRSVRA SLLRQLAK G + + G Sbjct: 621 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 655 >SB_55190| Best HMM Match : UCR_TM (HMM E-Value=8.9) Length = 89 Score = 56.0 bits (129), Expect = 3e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 575 LALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 +ALP +A H P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 13 VALPAAVA--HPP-FASWRNSEEARTDRPSQQLRSLNG 47 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 56.0 bits (129), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSEKARTDRPSQQLRSLNG Sbjct: 82 PPFASWRNSEKARTDRPSQQLRSLNG 107 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 68 ENPGVTQLNRLAAHPPF 84 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 58 LAVVLQRRDWENP 70 >SB_47281| Best HMM Match : Adaptin_N (HMM E-Value=0) Length = 949 Score = 56.0 bits (129), Expect = 3e-08 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLG 583 PFRLRNCWEGRSVRA SLLRQLAK G + + G Sbjct: 73 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 107 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAI 592 PFRLRNCWEGRSVRA SLLRQLAK G + + Sbjct: 397 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 428 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 617 KGGCAARRLSW 585 KGGCAARRLSW Sbjct: 420 KGGCAARRLSW 430 >SB_25859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 56.0 bits (129), Expect = 3e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 584 PNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 P++ H P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 23 PDIFQKSHPP-FASWRNSEEARTDRPSQQLRSLNG 56 >SB_17772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 56.0 bits (129), Expect = 3e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +2 Query: 578 ALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 A P + ++ P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 9 ANPIAVTVKPHPPFASWRNSEEARTDRPSQQLRSLNG 45 >SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 56.0 bits (129), Expect = 3e-08 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLG 583 PFRLRNCWEGRSVRA SLLRQLAK G + + G Sbjct: 209 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 243 >SB_2380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 56.0 bits (129), Expect = 3e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 599 LQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 LQ P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 21 LQAHPPFASWRNSEEARTDRPSQQLRSLNG 50 >SB_43774| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.21) Length = 429 Score = 55.6 bits (128), Expect = 4e-08 Identities = 29/61 (47%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIK-LGNARGFPSHDVVKRRPVNCNTTHYR 511 PFRLRNCWEGRSVRA SLLRQLAK G + + +G+ H + + +T YR Sbjct: 34 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVGDLENAIKHTKMMLKEEPESTKAYR 93 Query: 510 A 508 + Sbjct: 94 S 94 >SB_28437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/38 (71%), Positives = 29/38 (76%) Frame = +2 Query: 575 LALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 +ALP P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 47 IALPRSSKKGTHPPFASWRNSEEARTDRPSQQLRSLNG 84 >SB_20950| Best HMM Match : PHD (HMM E-Value=0.2) Length = 298 Score = 55.6 bits (128), Expect = 4e-08 Identities = 32/63 (50%), Positives = 36/63 (57%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNARGFPSHDVVKRRPVNCNTTHYRA 508 PFRLRNCWEGRSVRA SLLRQLAK G C A +L P + K+ T R Sbjct: 168 PFRLRNCWEGRSVRASSLLRQLAKGG--CAARRLSWDVADPLYAHCKQHADKQTTKSRRR 225 Query: 507 NWV 499 W+ Sbjct: 226 AWL 228 >SB_17408| Best HMM Match : I-set (HMM E-Value=7.4e-06) Length = 136 Score = 55.6 bits (128), Expect = 4e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +2 Query: 578 ALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 A+ +I + P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 86 AVATIIDVYTHPPFASWRNSEEARTDRPSQQLRSLNG 122 >SB_3686| Best HMM Match : Myotub-related (HMM E-Value=2.8e-08) Length = 629 Score = 55.6 bits (128), Expect = 4e-08 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNARGFPSHDVVK 547 PFRLRNCWEGRSVRA SLLRQLAK G C A +L + H +++ Sbjct: 34 PFRLRNCWEGRSVRASSLLRQLAKGG--CAARRLSWLFPYIEHAIIQ 78 >SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 55.6 bits (128), Expect = 4e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 683 SGCATVGKGDRCGPFRYYASWRKG 612 S CATVGKGDRCGP RYYASWRKG Sbjct: 61 SPCATVGKGDRCGPLRYYASWRKG 84 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = -3 Query: 678 LRNCWEGRSVRAFSLLRQLAKRGMCCKAI 592 LRNCWEGRSVRA SLLRQLAK G + + Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRL 30 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 617 KGGCAARRLSWVTPG 573 KGGCAARRLSWVTPG Sbjct: 22 KGGCAARRLSWVTPG 36 Score = 31.1 bits (67), Expect = 0.93 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 574 GFSQSRRCKTTAS 536 GFSQSRRCKTTAS Sbjct: 36 GFSQSRRCKTTAS 48 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 55.6 bits (128), Expect = 4e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -3 Query: 609 MCCKAIKLGNARGFPSHDVVKRRPV 535 MCCKAIKLGNAR FPSHDVVKRRPV Sbjct: 1 MCCKAIKLGNARVFPSHDVVKRRPV 25 >SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) Length = 857 Score = 55.2 bits (127), Expect = 5e-08 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNA 577 PFRLRNCWEGRSVRA SLLRQLAK G + + A Sbjct: 628 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWSTA 664 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 617 KGGCAARRLSWVTPG 573 KGGCAARRLSW T G Sbjct: 651 KGGCAARRLSWSTAG 665 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 55.2 bits (127), Expect = 5e-08 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 G+ + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 38 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 55.2 bits (127), Expect = 5e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNGRMAKL*AL 712 P FASWRNSE+ARTDRPSQQLRSLNG + AL Sbjct: 170 PPFASWRNSEEARTDRPSQQLRSLNGEWRLMRAL 203 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 156 ENPGVTQLNRLAAHPPF 172 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 146 LAVVLQRRDWENP 158 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 55.2 bits (127), Expect = 5e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNGRMAKL*AL 712 P FASWRNSE+ARTDRPSQQLRSLNG + AL Sbjct: 815 PPFASWRNSEEARTDRPSQQLRSLNGEWRLMRAL 848 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 801 ENPGVTQLNRLAAHPPF 817 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 791 LAVVLQRRDWENP 803 >SB_51573| Best HMM Match : UCR_TM (HMM E-Value=6.7) Length = 93 Score = 55.2 bits (127), Expect = 5e-08 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +2 Query: 569 KPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 +P +P+ H P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 13 RPNPVPSPSDAAHPP-FASWRNSEEARTDRPSQQLRSLNG 51 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 55.2 bits (127), Expect = 5e-08 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 G+ + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 63 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 103 >SB_24420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 608 Score = 55.2 bits (127), Expect = 5e-08 Identities = 32/52 (61%), Positives = 36/52 (69%), Gaps = 6/52 (11%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIK---LGNA-RGFPS--HDVV 550 PFRLRNCWEGRSVRA SLLRQLAK G + + L NA R FP H+V+ Sbjct: 76 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWLALQNALRYFPPEIHEVL 127 >SB_21827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 708 Score = 55.2 bits (127), Expect = 5e-08 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 4/46 (8%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAI----KLGNARGFPS 562 PFRLRNCWEGRSVRA SLLRQLAK G + + KL + +G S Sbjct: 346 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVNKLESTKGLTS 391 >SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 55.2 bits (127), Expect = 5e-08 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +2 Query: 584 PNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 P L+ P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 62 PPAETLEAHPPFASWRNSEEARTDRPSQQLRSLNG 96 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = -3 Query: 678 LRNCWEGRSVRAFSLLRQLAKRGMCCKAI 592 LRNCWEGRSVRA SLLRQLAK G + + Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRL 30 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 617 KGGCAARRLSWVTPG 573 KGGCAARRLSWVTPG Sbjct: 22 KGGCAARRLSWVTPG 36 Score = 31.1 bits (67), Expect = 0.93 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 574 GFSQSRRCKTTAS 536 GFSQSRRCKTTAS Sbjct: 36 GFSQSRRCKTTAS 48 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 55.2 bits (127), Expect = 5e-08 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 G+ + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 704 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 744 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 55.2 bits (127), Expect = 5e-08 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 G+ + L L P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 75 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 115 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 54.8 bits (126), Expect = 7e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRN+EKARTDRPSQQLRSLNG Sbjct: 73 PPFASWRNNEKARTDRPSQQLRSLNG 98 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 59 ENPGVTQLNRLAAHPPF 75 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 49 LAVVLQRRDWENP 61 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 54.8 bits (126), Expect = 7e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 599 LQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 L+ P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 86 LEAHPPFASWRNSEEARTDRPSQQLRSLNG 115 Score = 34.7 bits (76), Expect = 0.075 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 K PGVT LNRL AHPPF Sbjct: 76 KNPGVTPLNRLEAHPPF 92 >SB_27671| Best HMM Match : UCR_TM (HMM E-Value=0.82) Length = 151 Score = 54.8 bits (126), Expect = 7e-08 Identities = 26/41 (63%), Positives = 28/41 (68%) Frame = +2 Query: 566 GKPLALPNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 G P + P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 69 GMPFRAEEYTDVNAHPPFASWRNSEEARTDRPSQQLRSLNG 109 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 54.8 bits (126), Expect = 7e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRN+EKARTDRPSQQLRSLNG Sbjct: 71 PPFASWRNNEKARTDRPSQQLRSLNG 96 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 57 ENPGVTQLNRLAAHPPF 73 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 47 LAVVLQRRDWENP 59 >SB_18129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 54.8 bits (126), Expect = 7e-08 Identities = 27/49 (55%), Positives = 32/49 (65%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNARGFPSHDVVKRR 541 PFRLRNCWEGRSVRA SLLRQLAK G + + R + +V+ R Sbjct: 34 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWCVHRDLAARNVLLGR 82 >SB_51819| Best HMM Match : TGF_beta (HMM E-Value=1.9) Length = 696 Score = 54.8 bits (126), Expect = 7e-08 Identities = 32/59 (54%), Positives = 36/59 (61%), Gaps = 5/59 (8%) Frame = +2 Query: 527 LQFTGRRFTTS*LGKPLAL-----PNLIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 L F GR +S P + P + H P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 248 LSFNGRVIVSSDSATPTLVNFRYCPFVSGCPHPP-FASWRNSEEARTDRPSQQLRSLNG 305 >SB_40757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 54.8 bits (126), Expect = 7e-08 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +2 Query: 590 LIALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 LI H P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 20 LIIRAHPP-FASWRNSEEARTDRPSQQLRSLNG 51 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 54.8 bits (126), Expect = 7e-08 Identities = 35/66 (53%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = -3 Query: 678 LRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLG-NARGFPSHDVVKRRPVNCNTTHYRANW 502 LRNCWEGRSVRA SLLRQLAK G C A +L GF KRRPV + H + Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGG--CAARRLSWVTPGFSQSRRCKRRPV--PSLHACRST 57 Query: 501 VPGPPF 484 + PPF Sbjct: 58 LEDPPF 63 >SB_31018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 54.8 bits (126), Expect = 7e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 593 IALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 +A + P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 1 MAAETHPPFASWRNSEEARTDRPSQQLRSLNG 32 >SB_26019| Best HMM Match : F5_F8_type_C (HMM E-Value=2.6e-29) Length = 438 Score = 54.8 bits (126), Expect = 7e-08 Identities = 26/49 (53%), Positives = 32/49 (65%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNARGFPSHDVVKRR 541 PFRLRNCWEGRSVRA SLLRQLAK G + + + ++ VV + Sbjct: 188 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWEFYGNYDNNTVVTHK 236 >SB_17057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 54.8 bits (126), Expect = 7e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 599 LQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 L+ P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 46 LEAHPPFASWRNSEEARTDRPSQQLRSLNG 75 >SB_15776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 54.8 bits (126), Expect = 7e-08 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 593 IALQHIPLFASWRNSEKARTDRPSQQLRSLNG 688 + Q P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 34 VCRQAHPPFASWRNSEEARTDRPSQQLRSLNG 65 >SB_13740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 54.8 bits (126), Expect = 7e-08 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGN 580 PFRLRNCWEGRSVRA SLLRQLAK G + + N Sbjct: 34 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVN 69 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 617 KGGCAARRLSWVTP 576 KGGCAARRLSWV P Sbjct: 57 KGGCAARRLSWVNP 70 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAI 592 PFRLRNCWEGRSVRA SLLRQLAK G + + Sbjct: 474 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 505 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 617 KGGCAARRLSWVTPG 573 KGGCAARRLSWVTPG Sbjct: 497 KGGCAARRLSWVTPG 511 Score = 31.1 bits (67), Expect = 0.93 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 574 GFSQSRRCKTTAS 536 GFSQSRRCKTTAS Sbjct: 511 GFSQSRRCKTTAS 523 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 59 PPFASWRNSEEARTDRPSQQLRSLNG 84 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 45 ENPGVTQLNRLAAHPPF 61 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 35 LAVVLQRRDWENP 47 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 86 PPFASWRNSEEARTDRPSQQLRSLNG 111 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 72 ENPGVTQLNRLAAHPPF 88 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 62 LAVVLQRRDWENP 74 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 68 PPFASWRNSEEARTDRPSQQLRSLNG 93 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 54 ENPGVTQLNRLAAHPPF 70 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 44 LAVVLQRRDWENP 56 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 60 PPFASWRNSEEARTDRPSQQLRSLNG 85 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 46 ENPGVTQLNRLAAHPPF 62 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 36 LAVVLQRRDWENP 48 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 86 PPFASWRNSEEARTDRPSQQLRSLNG 111 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 72 ENPGVTQLNRLAAHPPF 88 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 62 LAVVLQRRDWENP 74 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 66 PPFASWRNSEEARTDRPSQQLRSLNG 91 Score = 34.3 bits (75), Expect = 0.100 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 577 GVTQLNRLAAHPPF 618 GVTQLNRLAAHPPF Sbjct: 55 GVTQLNRLAAHPPF 68 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 537 LAVVLQRRDWEN 572 LAVVLQRRDWEN Sbjct: 42 LAVVLQRRDWEN 53 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 91 PPFASWRNSEEARTDRPSQQLRSLNG 116 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 77 ENPGVTQLNRLAAHPPF 93 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 67 LAVVLQRRDWENP 79 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 62 PPFASWRNSEEARTDRPSQQLRSLNG 87 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 48 ENPGVTQLNRLAAHPPF 64 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 38 LAVVLQRRDWENP 50 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 82 PPFASWRNSEEARTDRPSQQLRSLNG 107 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 68 ENPGVTQLNRLAAHPPF 84 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 58 LAVVLQRRDWENP 70 >SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) Length = 751 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 501 PPFASWRNSEEARTDRPSQQLRSLNG 526 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 94 PPFASWRNSEEARTDRPSQQLRSLNG 119 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 80 ENPGVTQLNRLAAHPPF 96 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 70 LAVVLQRRDWENP 82 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAI 592 PFRLRNCWEGRSVRA SLLRQLAK G + + Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 52 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 617 KGGCAARRLSWVTPG 573 KGGCAARRLSWVTPG Sbjct: 44 KGGCAARRLSWVTPG 58 Score = 31.1 bits (67), Expect = 0.93 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 574 GFSQSRRCKTTAS 536 GFSQSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 32 PPFASWRNSEEARTDRPSQQLRSLNG 57 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAI 592 PFRLRNCWEGRSVRA SLLRQLAK G + + Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 617 KGGCAARRLSWVTPG 573 KGGCAARRLSWVTPG Sbjct: 29 KGGCAARRLSWVTPG 43 Score = 34.7 bits (76), Expect = 0.075 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 574 GFSQSRRCKTTASEL 530 GFSQSRRCKTTASEL Sbjct: 43 GFSQSRRCKTTASEL 57 >SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 70 PPFASWRNSEEARTDRPSQQLRSLNG 95 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 56 ENPGVTQLNRLAAHPPF 72 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 46 LAVVLQRRDWENP 58 >SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 59 PPFASWRNSEEARTDRPSQQLRSLNG 84 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 45 ENPGVTQLNRLAAHPPF 61 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 35 LAVVLQRRDWENP 47 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 49 PPFASWRNSEEARTDRPSQQLRSLNG 74 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 35 ENPGVTQLNRLAAHPPF 51 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 25 LAVVLQRRDWENP 37 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 74 PPFASWRNSEEARTDRPSQQLRSLNG 99 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 60 ENPGVTQLNRLAAHPPF 76 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 50 LAVVLQRRDWENP 62 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 83 PPFASWRNSEEARTDRPSQQLRSLNG 108 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 69 ENPGVTQLNRLAAHPPF 85 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 59 LAVVLQRRDWENP 71 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 77 PPFASWRNSEEARTDRPSQQLRSLNG 102 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 63 ENPGVTQLNRLAAHPPF 79 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 53 LAVVLQRRDWENP 65 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 93 PPFASWRNSEEARTDRPSQQLRSLNG 118 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 79 ENPGVTQLNRLAAHPPF 95 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 69 LAVVLQRRDWENP 81 >SB_58562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 81 PPFASWRNSEEARTDRPSQQLRSLNG 106 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 67 ENPGVTQLNRLAAHPPF 83 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 57 LAVVLQRRDWENP 69 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 64 PPFASWRNSEEARTDRPSQQLRSLNG 89 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 50 ENPGVTQLNRLAAHPPF 66 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 40 LAVVLQRRDWENP 52 >SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 34.3 bits (75), Expect = 0.100 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 577 GVTQLNRLAAHPPF 618 GVTQLNRLAAHPPF Sbjct: 42 GVTQLNRLAAHPPF 55 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 537 LAVVLQRRDWEN 572 LAVVLQRRDWEN Sbjct: 29 LAVVLQRRDWEN 40 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 240 PPFASWRNSEEARTDRPSQQLRSLNG 265 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 226 ENPGVTQLNRLAAHPPF 242 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 216 LAVVLQRRDWENP 228 >SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 135 PPFASWRNSEEARTDRPSQQLRSLNG 160 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 121 ENPGVTQLNRLAAHPPF 137 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 111 LAVVLQRRDWENP 123 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 73 PPFASWRNSEEARTDRPSQQLRSLNG 98 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 59 ENPGVTQLNRLAAHPPF 75 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 49 LAVVLQRRDWENP 61 >SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 52 PPFASWRNSEEARTDRPSQQLRSLNG 77 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 38 ENPGVTQLNRLAAHPPF 54 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 28 LAVVLQRRDWENP 40 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNG 65 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 26 ENPGVTQLNRLAAHPPF 42 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 16 LAVVLQRRDWENP 28 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 71 PPFASWRNSEEARTDRPSQQLRSLNG 96 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 57 ENPGVTQLNRLAAHPPF 73 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 47 LAVVLQRRDWENP 59 >SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 405 PPFASWRNSEEARTDRPSQQLRSLNG 430 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 391 ENPGVTQLNRLAAHPPF 407 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 381 LAVVLQRRDWENP 393 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 131 PPFASWRNSEEARTDRPSQQLRSLNG 156 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 117 ENPGVTQLNRLAAHPPF 133 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 107 LAVVLQRRDWENP 119 >SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 107 PPFASWRNSEEARTDRPSQQLRSLNG 132 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 93 ENPGVTQLNRLAAHPPF 109 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 83 LAVVLQRRDWENP 95 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 63 PPFASWRNSEEARTDRPSQQLRSLNG 88 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 49 ENPGVTQLNRLAAHPPF 65 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 39 LAVVLQRRDWENP 51 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 32 PPFASWRNSEEARTDRPSQQLRSLNG 57 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 18 ENPGVTQLNRLAAHPPF 34 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 8 LAVVLQRRDWENP 20 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 42 PPFASWRNSEEARTDRPSQQLRSLNG 67 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 28 ENPGVTQLNRLAAHPPF 44 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 18 LAVVLQRRDWENP 30 >SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 62 PPFASWRNSEEARTDRPSQQLRSLNG 87 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 48 ENPGVTQLNRLAAHPPF 64 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 38 LAVVLQRRDWENP 50 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 127 PPFASWRNSEEARTDRPSQQLRSLNG 152 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 113 ENPGVTQLNRLAAHPPF 129 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 103 LAVVLQRRDWENP 115 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 69 PPFASWRNSEEARTDRPSQQLRSLNG 94 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 55 ENPGVTQLNRLAAHPPF 71 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 45 LAVVLQRRDWENP 57 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 364 PPFASWRNSEEARTDRPSQQLRSLNG 389 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 350 ENPGVTQLNRLAAHPPF 366 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 340 LAVVLQRRDWENP 352 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 104 PPFASWRNSEEARTDRPSQQLRSLNG 129 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 90 ENPGVTQLNRLAAHPPF 106 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 80 LAVVLQRRDWENP 92 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 74 PPFASWRNSEEARTDRPSQQLRSLNG 99 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 60 ENPGVTQLNRLAAHPPF 76 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 50 LAVVLQRRDWENP 62 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNG 65 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 26 ENPGVTQLNRLAAHPPF 42 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 16 LAVVLQRRDWENP 28 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 83 PPFASWRNSEEARTDRPSQQLRSLNG 108 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 69 ENPGVTQLNRLAAHPPF 85 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 59 LAVVLQRRDWENP 71 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 67 PPFASWRNSEEARTDRPSQQLRSLNG 92 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 53 ENPGVTQLNRLAAHPPF 69 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 43 LAVVLQRRDWENP 55 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 158 PPFASWRNSEEARTDRPSQQLRSLNG 183 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 144 ENPGVTQLNRLAAHPPF 160 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 134 LAVVLQRRDWENP 146 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 87 PPFASWRNSEEARTDRPSQQLRSLNG 112 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 73 ENPGVTQLNRLAAHPPF 89 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 63 LAVVLQRRDWENP 75 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 63 PPFASWRNSEEARTDRPSQQLRSLNG 88 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 49 ENPGVTQLNRLAAHPPF 65 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 39 LAVVLQRRDWENP 51 >SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 167 PPFASWRNSEEARTDRPSQQLRSLNG 192 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 153 ENPGVTQLNRLAAHPPF 169 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 143 LAVVLQRRDWENP 155 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 857 PPFASWRNSEEARTDRPSQQLRSLNG 882 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 843 ENPGVTQLNRLAAHPPF 859 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 833 LAVVLQRRDWENP 845 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNG 65 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 26 ENPGVTQLNRLAAHPPF 42 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 16 LAVVLQRRDWENP 28 >SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 84 PPFASWRNSEEARTDRPSQQLRSLNG 109 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 70 ENPGVTQLNRLAAHPPF 86 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 60 LAVVLQRRDWENP 72 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNG 83 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 44 ENPGVTQLNRLAAHPPF 60 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 34 LAVVLQRRDWENP 46 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 97 PPFASWRNSEEARTDRPSQQLRSLNG 122 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 83 ENPGVTQLNRLAAHPPF 99 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 73 LAVVLQRRDWENP 85 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 59 PPFASWRNSEEARTDRPSQQLRSLNG 84 Score = 34.3 bits (75), Expect = 0.100 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 577 GVTQLNRLAAHPPF 618 GVTQLNRLAAHPPF Sbjct: 48 GVTQLNRLAAHPPF 61 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 537 LAVVLQRRDWEN 572 LAVVLQRRDWEN Sbjct: 35 LAVVLQRRDWEN 46 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 80 PPFASWRNSEEARTDRPSQQLRSLNG 105 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 66 ENPGVTQLNRLAAHPPF 82 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 56 LAVVLQRRDWENP 68 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 93 PPFASWRNSEEARTDRPSQQLRSLNG 118 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 79 ENPGVTQLNRLAAHPPF 95 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 69 LAVVLQRRDWENP 81 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 89 PPFASWRNSEEARTDRPSQQLRSLNG 114 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 75 ENPGVTQLNRLAAHPPF 91 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQR DWENP Sbjct: 65 LAVVLQRLDWENP 77 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 280 PPFASWRNSEEARTDRPSQQLRSLNG 305 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 266 ENPGVTQLNRLAAHPPF 282 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 256 LAVVLQRRDWENP 268 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 34.3 bits (75), Expect = 0.100 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 577 GVTQLNRLAAHPPF 618 GVTQLNRLAAHPPF Sbjct: 42 GVTQLNRLAAHPPF 55 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 537 LAVVLQRRDWEN 572 LAVVLQRRDWEN Sbjct: 29 LAVVLQRRDWEN 40 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 138 PPFASWRNSEEARTDRPSQQLRSLNG 163 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 124 ENPGVTQLNRLAAHPPF 140 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 114 LAVVLQRRDWENP 126 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 74 PPFASWRNSEEARTDRPSQQLRSLNG 99 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 60 ENPGVTQLNRLAAHPPF 76 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 50 LAVVLQRRDWENP 62 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 60 PPFASWRNSEEARTDRPSQQLRSLNG 85 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 46 ENPGVTQLNRLAAHPPF 62 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 36 LAVVLQRRDWENP 48 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 61 PPFASWRNSEEARTDRPSQQLRSLNG 86 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 47 ENPGVTQLNRLAAHPPF 63 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 37 LAVVLQRRDWENP 49 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 125 PPFASWRNSEEARTDRPSQQLRSLNG 150 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 111 ENPGVTQLNRLAAHPPF 127 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 101 LAVVLQRRDWENP 113 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 138 PPFASWRNSEEARTDRPSQQLRSLNG 163 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 124 ENPGVTQLNRLAAHPPF 140 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 114 LAVVLQRRDWENP 126 >SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 63 PPFASWRNSEEARTDRPSQQLRSLNG 88 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 49 ENPGVTQLNRLAAHPPF 65 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 39 LAVVLQRRDWENP 51 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNG 69 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 30 ENPGVTQLNRLAAHPPF 46 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 20 LAVVLQRRDWENP 32 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 82 PPFASWRNSEEARTDRPSQQLRSLNG 107 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 68 ENPGVTQLNRLAAHPPF 84 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 58 LAVVLQRRDWENP 70 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 61 PPFASWRNSEEARTDRPSQQLRSLNG 86 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 47 ENPGVTQLNRLAAHPPF 63 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 37 LAVVLQRRDWENP 49 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAI 592 PFRLRNCWEGRSVRA SLLRQLAK G + + Sbjct: 218 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 249 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 617 KGGCAARRLSWVTPG 573 KGGCAARRLSWVTPG Sbjct: 241 KGGCAARRLSWVTPG 255 Score = 34.7 bits (76), Expect = 0.075 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 574 GFSQSRRCKTTASEL 530 GFSQSRRCKTTASEL Sbjct: 255 GFSQSRRCKTTASEL 269 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNG 83 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 44 ENPGVTQLNRLAAHPPF 60 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 34 LAVVLQRRDWENP 46 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 35 PPFASWRNSEEARTDRPSQQLRSLNG 60 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 21 ENPGVTQLNRLAAHPPF 37 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 11 LAVVLQRRDWENP 23 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 43 PPFASWRNSEEARTDRPSQQLRSLNG 68 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 29 ENPGVTQLNRLAAHPPF 45 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 19 LAVVLQRRDWENP 31 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 420 PPFASWRNSEEARTDRPSQQLRSLNG 445 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 406 ENPGVTQLNRLAAHPPF 422 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 396 LAVVLQRRDWENP 408 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 69 PPFASWRNSEEARTDRPSQQLRSLNG 94 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 55 ENPGVTQLNRLAAHPPF 71 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 45 LAVVLQRRDWENP 57 >SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 78 PPFASWRNSEEARTDRPSQQLRSLNG 103 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 64 ENPGVTQLNRLAAHPPF 80 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 54 LAVVLQRRDWENP 66 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 60 PPFASWRNSEEARTDRPSQQLRSLNG 85 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 46 ENPGVTQLNRLAAHPPF 62 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 36 LAVVLQRRDWENP 48 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 143 PPFASWRNSEEARTDRPSQQLRSLNG 168 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 129 ENPGVTQLNRLAAHPPF 145 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 119 LAVVLQRRDWENP 131 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 79 PPFASWRNSEEARTDRPSQQLRSLNG 104 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 65 ENPGVTQLNRLAAHPPF 81 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 55 LAVVLQRRDWENP 67 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 89 PPFASWRNSEEARTDRPSQQLRSLNG 114 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 75 ENPGVTQLNRLAAHPPF 91 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 65 LAVVLQRRDWENP 77 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 92 PPFASWRNSEEARTDRPSQQLRSLNG 117 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 78 ENPGVTQLNRLAAHPPF 94 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 68 LAVVLQRRDWENP 80 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAI 592 PFRLRNCWEGRSVRA SLLRQLAK G + + Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 52 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 617 KGGCAARRLSWVTPG 573 KGGCAARRLSWVTPG Sbjct: 44 KGGCAARRLSWVTPG 58 Score = 31.1 bits (67), Expect = 0.93 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 574 GFSQSRRCKTTAS 536 GFSQSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 438 PPFASWRNSEEARTDRPSQQLRSLNG 463 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 424 ENPGVTQLNRLAAHPPF 440 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 414 LAVVLQRRDWENP 426 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 135 PPFASWRNSEEARTDRPSQQLRSLNG 160 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 121 ENPGVTQLNRLAAHPPF 137 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 111 LAVVLQRRDWENP 123 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 91 PPFASWRNSEEARTDRPSQQLRSLNG 116 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 77 ENPGVTQLNRLAAHPPF 93 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 67 LAVVLQRRDWENP 79 >SB_54117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 61 PPFASWRNSEEARTDRPSQQLRSLNG 86 >SB_54092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 80 PPFASWRNSEEARTDRPSQQLRSLNG 105 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 66 ENPGVTQLNRLAAHPPF 82 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 56 LAVVLQRRDWENP 68 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 70 PPFASWRNSEEARTDRPSQQLRSLNG 95 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 56 ENPGVTQLNRLAAHPPF 72 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 46 LAVVLQRRDWENP 58 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 34.3 bits (75), Expect = 0.100 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 577 GVTQLNRLAAHPPF 618 GVTQLNRLAAHPPF Sbjct: 42 GVTQLNRLAAHPPF 55 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 537 LAVVLQRRDWEN 572 LAVVLQRRDWEN Sbjct: 29 LAVVLQRRDWEN 40 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 185 PPFASWRNSEEARTDRPSQQLRSLNG 210 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 171 ENPGVTQLNRLAAHPPF 187 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 161 LAVVLQRRDWENP 173 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_53629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 89 PPFASWRNSEEARTDRPSQQLRSLNG 114 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 75 ENPGVTQLNRLAAHPPF 91 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 65 LAVVLQRRDWENP 77 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 76 PPFASWRNSEEARTDRPSQQLRSLNG 101 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 62 ENPGVTQLNRLAAHPPF 78 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 52 LAVVLQRRDWENP 64 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 112 PPFASWRNSEEARTDRPSQQLRSLNG 137 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 98 ENPGVTQLNRLAAHPPF 114 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 88 LAVVLQRRDWENP 100 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 78 PPFASWRNSEEARTDRPSQQLRSLNG 103 Score = 34.3 bits (75), Expect = 0.100 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 577 GVTQLNRLAAHPPF 618 GVTQLNRLAAHPPF Sbjct: 67 GVTQLNRLAAHPPF 80 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 537 LAVVLQRRDWEN 572 LAVVLQRRDWEN Sbjct: 54 LAVVLQRRDWEN 65 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 61 PPFASWRNSEEARTDRPSQQLRSLNG 86 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 47 ENPGVTQLNRLAAHPPF 63 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 37 LAVVLQRRDWENP 49 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 87 PPFASWRNSEEARTDRPSQQLRSLNG 112 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 73 ENPGVTQLNRLAAHPPF 89 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 63 LAVVLQRRDWENP 75 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_53123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -3 Query: 687 PFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAI 592 PFRLRNCWEGRSVRA SLLRQLAK G + + Sbjct: 67 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 98 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 617 KGGCAARRLSWVTPG 573 KGGCAARRLSWVTPG Sbjct: 90 KGGCAARRLSWVTPG 104 Score = 31.1 bits (67), Expect = 0.93 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 574 GFSQSRRCKTTAS 536 GFSQSRRCKTTAS Sbjct: 104 GFSQSRRCKTTAS 116 >SB_52872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNG 28 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 66 PPFASWRNSEEARTDRPSQQLRSLNG 91 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 52 ENPGVTQLNRLAAHPPF 68 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 42 LAVVLQRRDWENP 54 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNG 78 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 39 ENPGVTQLNRLAAHPPF 55 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) Length = 129 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 62 PPFASWRNSEEARTDRPSQQLRSLNG 87 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 209 PPFASWRNSEEARTDRPSQQLRSLNG 234 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 195 ENPGVTQLNRLAAHPPF 211 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 185 LAVVLQRRDWENP 197 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNG 83 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 44 ENPGVTQLNRLAAHPPF 60 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 34 LAVVLQRRDWENP 46 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 64 PPFASWRNSEEARTDRPSQQLRSLNG 89 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 50 ENPGVTQLNRLAAHPPF 66 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 40 LAVVLQRRDWENP 52 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 54.4 bits (125), Expect = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 611 PLFASWRNSEKARTDRPSQQLRSLNG 688 P FASWRNSE+ARTDRPSQQLRSLNG Sbjct: 78 PPFASWRNSEEARTDRPSQQLRSLNG 103 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 568 KTPGVTQLNRLAAHPPF 618 + PGVTQLNRLAAHPPF Sbjct: 64 ENPGVTQLNRLAAHPPF 80 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 537 LAVVLQRRDWENP 575 LAVVLQRRDWENP Sbjct: 54 LAVVLQRRDWENP 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,922,309 Number of Sequences: 59808 Number of extensions: 378239 Number of successful extensions: 10829 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10751 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -