BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0388 (713 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 25 1.8 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 9.5 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 23 9.5 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 25.4 bits (53), Expect = 1.8 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = -3 Query: 693 IRPFRLRNCWEGRSVRAFSLLRQLAKRGMCCKAIKLGNARGFP 565 +R LRN +EG++V LLR + +A KL N FP Sbjct: 198 LRTATLRNDFEGQAVLINCLLRNYLHYSLYDQADKLVNKSVFP 240 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 502 GTGPPLQTQNK 470 GTG PL+TQNK Sbjct: 646 GTGLPLRTQNK 656 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -3 Query: 69 QSYNEDGEQNEQFREHFEQFSK 4 +S+ E +Q + REH+EQ + Sbjct: 894 KSFREKQDQLARMREHYEQIQR 915 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 330 FVDYFRFTKRLCF*VFFFLMST 395 F +YF+F KR + FFL T Sbjct: 355 FSNYFKFDKRTSQAMIFFLQMT 376 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 664,112 Number of Sequences: 2352 Number of extensions: 12635 Number of successful extensions: 24 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -