BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0386 (667 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G6.07c |||SNARE Slt1 |Schizosaccharomyces pombe|chr 1|||Ma... 29 0.80 SPAP8A3.14c |||mitochondrial inner membrane protein |Schizosacch... 25 7.4 >SPAC17G6.07c |||SNARE Slt1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 222 Score = 28.7 bits (61), Expect = 0.80 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 610 STNPEQSHWLQLNYVRDFLISFFILTFLVTFT 515 S + S WLQL + ++SF ++ F++ FT Sbjct: 187 SKSKRLSFWLQLGMIIAVVVSFIVMIFILQFT 218 >SPAP8A3.14c |||mitochondrial inner membrane protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 677 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 54 MLK*NDLTVCTLEMFFHVIVFAS 122 ML D+T+C LEMFF ++ AS Sbjct: 167 MLAIKDVTLCPLEMFFLLLNNAS 189 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,269,336 Number of Sequences: 5004 Number of extensions: 39323 Number of successful extensions: 63 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 303841898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -