BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0386 (667 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54190.1 68418.m06747 protochlorophyllide reductase A, chloro... 28 4.9 At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyc... 27 8.5 >At5g54190.1 68418.m06747 protochlorophyllide reductase A, chloroplast / PCR A / NADPH-protochlorophyllide oxidoreductase A (PORA) identical to SP:Q42536 protochlorophyllide reductase A, chloroplast precursor (EC 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) [Arabidopsis thaliana] Length = 405 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/53 (20%), Positives = 25/53 (47%) Frame = -1 Query: 166 NDIKNDGIMNGT*YIDANTIT*KNISNVHTVKSFHFNIHINTN*FYPCNFPAC 8 N + + +++G ++ A + N+ T++ FH H +T + +P C Sbjct: 261 NGLNSSAMIDGGDFVGAKAYKDSKVCNMLTMQEFHRRFHEDTGITFASLYPGC 313 >At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein weak similarity to CARS-Cyp [Homo sapiens] GI:1117968; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 837 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 208 TISIIILRCKNYAYNDIKNDGIMNG 134 T+S+ I+RC Y+ + K+DG NG Sbjct: 164 TVSVKIIRCGEYSGDKKKSDGKKNG 188 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,956,114 Number of Sequences: 28952 Number of extensions: 176527 Number of successful extensions: 323 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 323 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -