BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0384 (323 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 20 5.6 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 20 5.6 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 20 5.6 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 20 5.6 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 20.2 bits (40), Expect = 5.6 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +1 Query: 199 IVQTSYSIE*LKRFTGFPFLVKIFFYGPGWALILG 303 +++ Y + F G L + +GP W L+ G Sbjct: 260 VIEFQYGLSLGNAFQGGNQLANLANWGPEWNLLDG 294 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 20.2 bits (40), Expect = 5.6 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +1 Query: 199 IVQTSYSIE*LKRFTGFPFLVKIFFYGPGWALILG 303 +++ Y + F G L + +GP W L+ G Sbjct: 261 VIEFQYGLSLGNAFQGGNQLANLANWGPEWNLLDG 295 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 20.2 bits (40), Expect = 5.6 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +1 Query: 199 IVQTSYSIE*LKRFTGFPFLVKIFFYGPGWALILG 303 +++ Y + F G L + +GP W L+ G Sbjct: 261 VIEFQYGLSLGNAFQGGNQLANLANWGPEWNLLDG 295 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 20.2 bits (40), Expect = 5.6 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 68 RPISHHSSLDSFEIKIEVAVQISNHIHHFSNN 163 RP H+ ++ S + ++ +H FSNN Sbjct: 216 RPWIHNETIYSLTPQGRKEQKVLKSLHSFSNN 247 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,794 Number of Sequences: 336 Number of extensions: 1403 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6155018 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -