BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0383 (633 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z73102-2|CAB63428.1| 341|Caenorhabditis elegans Hypothetical pr... 29 2.1 Z73102-1|CAA97419.1| 298|Caenorhabditis elegans Hypothetical pr... 29 2.1 AF025469-5|AAG00029.1| 2054|Caenorhabditis elegans Hypothetical ... 29 2.8 U51998-7|AAA96080.2| 769|Caenorhabditis elegans Hypothetical pr... 28 4.8 U51998-6|ABS83845.1| 825|Caenorhabditis elegans Hypothetical pr... 28 4.8 U51998-5|AAL00856.2| 648|Caenorhabditis elegans Hypothetical pr... 28 4.8 Z73425-2|CAA97788.1| 1126|Caenorhabditis elegans Hypothetical pr... 28 6.4 Z99772-1|CAB16921.1| 794|Caenorhabditis elegans Hypothetical pr... 27 8.4 Z75550-14|CAA99932.1| 794|Caenorhabditis elegans Hypothetical p... 27 8.4 >Z73102-2|CAB63428.1| 341|Caenorhabditis elegans Hypothetical protein B0035.1b protein. Length = 341 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 351 PYEPPTADIYTQQSYSAPSSYQDGGY 428 P PP + + Q Y AP Y GGY Sbjct: 227 PRTPPYENEHEHQDYQAPDDYNQGGY 252 >Z73102-1|CAA97419.1| 298|Caenorhabditis elegans Hypothetical protein B0035.1a protein. Length = 298 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 351 PYEPPTADIYTQQSYSAPSSYQDGGY 428 P PP + + Q Y AP Y GGY Sbjct: 227 PRTPPYENEHEHQDYQAPDDYNQGGY 252 >AF025469-5|AAG00029.1| 2054|Caenorhabditis elegans Hypothetical protein W09B6.1a protein. Length = 2054 Score = 29.1 bits (62), Expect = 2.8 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +1 Query: 310 LNQMDMYHHTLDISHMSHQLLIFIHN 387 L Q+ HHT +IS+++ ++L+F H+ Sbjct: 906 LRQIGNLHHTEEISNLAREILLFYHS 931 >U51998-7|AAA96080.2| 769|Caenorhabditis elegans Hypothetical protein C12D12.1a protein. Length = 769 Score = 28.3 bits (60), Expect = 4.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 336 HTGYQPYEPPTADIYTQQSY 395 H Y P+ PP++D YT Y Sbjct: 241 HVAYMPHPPPSSDCYTYDYY 260 >U51998-6|ABS83845.1| 825|Caenorhabditis elegans Hypothetical protein C12D12.1c protein. Length = 825 Score = 28.3 bits (60), Expect = 4.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 336 HTGYQPYEPPTADIYTQQSY 395 H Y P+ PP++D YT Y Sbjct: 241 HVAYMPHPPPSSDCYTYDYY 260 >U51998-5|AAL00856.2| 648|Caenorhabditis elegans Hypothetical protein C12D12.1b protein. Length = 648 Score = 28.3 bits (60), Expect = 4.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 336 HTGYQPYEPPTADIYTQQSY 395 H Y P+ PP++D YT Y Sbjct: 241 HVAYMPHPPPSSDCYTYDYY 260 >Z73425-2|CAA97788.1| 1126|Caenorhabditis elegans Hypothetical protein F12F6.6 protein. Length = 1126 Score = 27.9 bits (59), Expect = 6.4 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +3 Query: 345 YQPYEPPTADI--YTQQSYSAPSSYQDGGYSAPAAAQ 449 YQP PP + Y QQ ++ +Q G+ PAA Q Sbjct: 3 YQP--PPNGQMPGYPQQQFNQQPQFQSNGFPPPAAPQ 37 >Z99772-1|CAB16921.1| 794|Caenorhabditis elegans Hypothetical protein H05L14.1 protein. Length = 794 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +1 Query: 499 QQVVQEVTKMM---VTAAEWAGRVTPVTEQQSPHTA 597 +++VQ V K +T +W G++TPV ++ + TA Sbjct: 386 KEIVQNVGKSKGHDMTTCDWVGKITPVNQEIAIKTA 421 >Z75550-14|CAA99932.1| 794|Caenorhabditis elegans Hypothetical protein H05L14.1 protein. Length = 794 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +1 Query: 499 QQVVQEVTKMM---VTAAEWAGRVTPVTEQQSPHTA 597 +++VQ V K +T +W G++TPV ++ + TA Sbjct: 386 KEIVQNVGKSKGHDMTTCDWVGKITPVNQEIAIKTA 421 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,192,248 Number of Sequences: 27780 Number of extensions: 185200 Number of successful extensions: 759 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 759 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1395683256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -