BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0380 (762 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC31A2.06 |||conserved fungal protein|Schizosaccharomyces pomb... 30 0.31 SPAC6G10.04c |||20S proteasome component alpha 6 subunit Pre5|Sc... 25 8.9 >SPAC31A2.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 542 Score = 30.3 bits (65), Expect = 0.31 Identities = 12/49 (24%), Positives = 22/49 (44%) Frame = -3 Query: 529 NWNCKFVYYYDCILFFYNHKFRQDYTIKNINKDKQYLIYSQFDNRRQEQ 383 NW C + + + FR+ Y + NI K +YS ++ +Q + Sbjct: 188 NWTCLSIENFGISIHVITKNFREYYKLDNIEHVKDETLYSDLEHGKQSR 236 >SPAC6G10.04c |||20S proteasome component alpha 6 subunit Pre5|Schizosaccharomyces pombe|chr 1|||Manual Length = 272 Score = 25.4 bits (53), Expect = 8.9 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 463 QDYTIKNINKDKQYLIYSQFDNRRQEQKFDNK*YACVCAS 344 ++ +I I KD++Y +Y Q D + K +K A AS Sbjct: 208 ENVSISVIGKDEKYTLYDQNDTKEWLDKLGDKGPAAARAS 247 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,091,519 Number of Sequences: 5004 Number of extensions: 63114 Number of successful extensions: 132 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 365309308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -