BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0380 (762 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5878| Best HMM Match : Tyrosinase (HMM E-Value=0.33) 30 2.4 SB_31500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_5878| Best HMM Match : Tyrosinase (HMM E-Value=0.33) Length = 292 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 5/42 (11%) Frame = +2 Query: 167 RKNFVSLFTKIARTKDYE-----IFHTYREYREEVHNANNFL 277 R+ F++ F K+ + K Y+ I +RE+R +H+A FL Sbjct: 48 RRRFIAAFKKLTKDKRYKKEYDTIVRVHREHRTMIHSARYFL 89 >SB_31500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1446 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 209 KDYEIFHTYREYREEVHNANNFLK 280 KDYEI T+RE R E ++ N LK Sbjct: 325 KDYEIQQTHRELRTEYNHVFNQLK 348 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,027,252 Number of Sequences: 59808 Number of extensions: 434334 Number of successful extensions: 1051 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 983 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1050 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -