BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0377 (593 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55766| Best HMM Match : Keratin_B2 (HMM E-Value=1.8) 29 2.8 SB_47115| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_55766| Best HMM Match : Keratin_B2 (HMM E-Value=1.8) Length = 245 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -1 Query: 419 SFNTSSARRLVDILPYITCENTRLCVAIQE*DGGTELLGPSTQGS 285 S NTS + +D+ P ITC T C +G ++G +T GS Sbjct: 144 STNTSGSSTTIDVCPIITCTTTSSCCTTF--NGSPTIIG-TTSGS 185 >SB_47115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 830 Score = 27.5 bits (58), Expect = 8.6 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +1 Query: 355 VFSQVI*GKISTKRRALEVLKLLPQRAMRLSSFHYDVFFLFNFLK 489 +FSQ K S + A E +K++PQ RL YD F L + LK Sbjct: 586 LFSQS--NKKSVRETAKEFMKMMPQMRKRLDQREYD-FILMSPLK 627 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,616,935 Number of Sequences: 59808 Number of extensions: 343669 Number of successful extensions: 661 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 661 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -