BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0377 (593 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 25 1.4 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 25 2.4 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 23 5.6 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 25.4 bits (53), Expect = 1.4 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +3 Query: 249 GINVNEHLSQVGGSLSAGSE*FSTTV-LLLYCDTQSCVLAGNIR*DI 386 G+ +NE +QV S AGSE STT+ LY ++ + G +R +I Sbjct: 295 GLTMNELAAQVFVSFLAGSETSSTTMNFCLYELAKNPDIQGRLREEI 341 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 24.6 bits (51), Expect = 2.4 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = +2 Query: 113 YEKHTFFKYPQACGWTLVFLLSPVWFPGKNRTTPSHPVDVVRGD 244 Y H F YP+ L + + W+P + P HP + G+ Sbjct: 4 YYNH-FAMYPKNHSGNLPYSATTGWYPSNYQHQPPHPQFIGDGE 46 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 23.4 bits (48), Expect = 5.6 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 391 KRRALEVLKLLPQRAMRLSSFHYDVFFLF 477 K+R VL+ LPQ + F Y VF +F Sbjct: 560 KKRISIVLEFLPQIIFLVLLFAYMVFMMF 588 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 600,010 Number of Sequences: 2352 Number of extensions: 11088 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -