BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0375 (698 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006708-2|AAF60418.1| 501|Caenorhabditis elegans Temporarily a... 29 2.4 AC087079-15|ABF71716.1| 152|Caenorhabditis elegans Hypothetical... 29 3.2 AY494975-1|AAR87492.1| 486|Caenorhabditis elegans collagen/olfa... 27 9.8 AF000262-4|AAN60526.2| 486|Caenorhabditis elegans Colmedin (col... 27 9.8 >AC006708-2|AAF60418.1| 501|Caenorhabditis elegans Temporarily assigned gene nameprotein 300 protein. Length = 501 Score = 29.5 bits (63), Expect = 2.4 Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 2/91 (2%) Frame = +1 Query: 289 TFVDVGGPGCVHMKYVSPDEGFMVKISYGKNLIHSSKIQGSNPEPICLQVFDKLAEVCAK 468 T V GP + P +VKI+ I ++ S+ +QVF+ V AK Sbjct: 43 TVFGVNGPLVIVHNVKFPMFNEIVKITLPNGQIRMGQVLESSKNKAVVQVFEGTTGVDAK 102 Query: 469 FSELAPTSEGIRG--CLELEPRIFFGSANTV 555 F+ T + R L++ RIF GS + Sbjct: 103 FTTCEFTGDIFRSPVSLDMLGRIFNGSGKPI 133 >AC087079-15|ABF71716.1| 152|Caenorhabditis elegans Hypothetical protein Y37E3.19 protein. Length = 152 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 350 PSSGETYFMWTQPGPPTSTNVILKLTQQTQACPLHKQFLLDSS 222 P G F +T P T+ L Q+ Q CP+H +F D++ Sbjct: 48 PQGGNETFHFTPPHIKTAVPTRSLLRQKHQQCPVHYEFSEDAT 90 >AY494975-1|AAR87492.1| 486|Caenorhabditis elegans collagen/olfactomedin domain containingprotein 2 protein. Length = 486 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -1 Query: 314 PGPPTSTNVILKLTQQTQACPLHKQFLLDSSLRCSGTSIRNCPNR 180 PGP I K +CP+ + L++ +C CPNR Sbjct: 124 PGPVGPPGNIGK-DADCSSCPIRDELLMEREFKCPTIENLECPNR 167 >AF000262-4|AAN60526.2| 486|Caenorhabditis elegans Colmedin (collagen plus olfactomedin)family protein 2 protein. Length = 486 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -1 Query: 314 PGPPTSTNVILKLTQQTQACPLHKQFLLDSSLRCSGTSIRNCPNR 180 PGP I K +CP+ + L++ +C CPNR Sbjct: 124 PGPVGPPGNIGK-DADCSSCPIRDELLMEREFKCPTIENLECPNR 167 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,944,202 Number of Sequences: 27780 Number of extensions: 309006 Number of successful extensions: 788 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 788 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -