BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0375 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 3.7 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 3.7 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 22 4.9 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 21 8.5 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 8.5 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 Query: 525 QDIFWFRKYSFRLAASNQH 581 QD FW +YS+ L + H Sbjct: 318 QDSFWLEQYSWALFKAMSH 336 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 Query: 525 QDIFWFRKYSFRLAASNQH 581 QD FW +YS+ L + H Sbjct: 286 QDSFWLEQYSWALFKAMSH 304 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +2 Query: 368 LTAKTLYTAVKFKGATQNRFVFKYSIN*QKSALNLVSWH 484 +T + Y +K G T+N + Y+I+ K L+ S++ Sbjct: 84 VTLRQEYKNIKLYGLTKNLEIKNYNIDWDKCILSSESYN 122 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = -2 Query: 325 CGHNLVHPRQRMSY*N*HSKRRLVPCTNSFY*TRHC 218 C ++ V+ S+ HS C N Y T++C Sbjct: 22 CSYSCVNKSMLNSHLKSHSNVYQYRCANCTYATKYC 57 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 229 TRHCVVPVRRLE 194 TR+C+ P RLE Sbjct: 145 TRYCLTPTERLE 156 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 229 TRHCVVPVRRLE 194 TR+C+ P RLE Sbjct: 198 TRYCLTPTERLE 209 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,728 Number of Sequences: 438 Number of extensions: 3768 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -