BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0373 (710 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1541 - 38127014-38128022,38128116-38128209,38128302-381285... 28 6.4 08_02_0462 + 17444726-17445135,17445271-17445546,17446523-17448461 28 8.4 >01_06_1541 - 38127014-38128022,38128116-38128209,38128302-38128535, 38128643-38128744,38130893-38130956 Length = 500 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = -2 Query: 409 CYKEW*AHN---GIFIHEDYAHPLGQTAILEWTPC 314 CY++W A F H +YA PLG + +T C Sbjct: 368 CYEKWLASRWPESAFFHREYAVPLGGGRAVRFTLC 402 >08_02_0462 + 17444726-17445135,17445271-17445546,17446523-17448461 Length = 874 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -1 Query: 338 SHSRMDSVLFYFLFLPAIFDHRHNRIARYQCTRYLLGH 225 SH+R V Y LP++ + RH R+ ++ ++L H Sbjct: 504 SHARSLDVFCYQPKLPSLLEFRHLRVLSFRYCKWLKSH 541 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,387,763 Number of Sequences: 37544 Number of extensions: 286662 Number of successful extensions: 558 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 558 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -