BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0372 (738 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.6 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 23 3.4 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 22 4.5 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 7.9 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 7.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 6/34 (17%) Frame = -2 Query: 710 GHKPFQN*WMVPTSARF------HSWQTRLNSLT 627 GHKP + W PT + + WQT+ + T Sbjct: 1158 GHKPSTSSWQKPTKPSYRPPSTTNHWQTKTTTST 1191 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 690 ILEWFVAMLFTGAI 731 +L WF+A LFT I Sbjct: 192 LLAWFIAALFTSPI 205 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -2 Query: 401 SNIKPHSKKLLSRTGYSRSTKFSK 330 S ++PH + + ++GY++ T K Sbjct: 163 SGLRPHLLENVKKSGYTKPTAIQK 186 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 690 ILEWFVAMLFT 722 +L WF+A LFT Sbjct: 192 LLAWFIAALFT 202 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 Query: 146 TVITYSLQKLLCYT 105 TV Y+L+KLLC T Sbjct: 1448 TVEKYTLEKLLCGT 1461 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,571 Number of Sequences: 336 Number of extensions: 3655 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -