BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0371 (703 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70310.1 68414.m08089 spermidine synthase 2 (SPDSYN2) / putre... 111 4e-25 At1g23820.2 68414.m03004 spermidine synthase 1 (SPDSYN1) / putre... 110 8e-25 At1g23820.1 68414.m03005 spermidine synthase 1 (SPDSYN1) / putre... 110 8e-25 At5g53120.3 68418.m06603 spermidine synthase, putative / putresc... 105 2e-23 At5g53120.2 68418.m06602 spermidine synthase, putative / putresc... 105 2e-23 At5g53120.1 68418.m06601 spermidine synthase, putative / putresc... 105 2e-23 At5g19530.1 68418.m02326 spermine/spermidine synthase family pro... 77 2e-14 At2g04920.1 68415.m00513 F-box family protein (FBX9) identical t... 31 0.74 At4g14580.1 68417.m02244 CBL-interacting protein kinase 4 (CIPK4... 30 1.3 At4g11800.1 68417.m01879 calcineurin-like phosphoesterase family... 29 3.0 At3g04350.1 68416.m00460 expressed protein 29 3.0 At5g11300.1 68418.m01319 cyclin, putative (CYC3b) similar to cyc... 28 5.2 At1g29900.1 68414.m03654 carbamoyl-phosphate synthase family pro... 28 6.9 At1g14460.1 68414.m01715 DNA polymerase-related weak similarity ... 28 6.9 >At1g70310.1 68414.m08089 spermidine synthase 2 (SPDSYN2) / putrescine aminopropyltransferase 2 identical to SP|O48661 Spermidine synthase 2 (EC 2.5.1.16) (Putrescine aminopropyltransferase 2) (SPDSY 2) {Arabidopsis thaliana} Length = 340 Score = 111 bits (267), Expect = 4e-25 Identities = 48/93 (51%), Positives = 66/93 (70%) Frame = +2 Query: 329 MDKLKTNWFTESCDMWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCT 508 M + WF+E MWPG S +V+++L KS YQ++ VF + + GKVLVLDG+IQ T Sbjct: 44 MSSIIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT 103 Query: 509 QKDEFSYQEMISFLPLCCHKNPENVLIVGGGDG 607 ++DE +YQEMI+ LPLC NP+ VL++GGGDG Sbjct: 104 ERDECAYQEMITHLPLCSISNPKKVLVIGGGDG 136 Score = 30.7 bits (66), Expect = 0.98 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 622 EVAKHPQVKHIVLVEIDDRVIELSKRY 702 EVA+H V+ I + EID V++++K+Y Sbjct: 141 EVARHSSVEQIDICEIDKMVVDVAKQY 167 >At1g23820.2 68414.m03004 spermidine synthase 1 (SPDSYN1) / putrescine aminopropyltransferase 1 identical to SP|Q9ZUB3 Spermidine synthase 1 (EC 2.5.1.16) (Putrescine aminopropyltransferase 1) (SPDSY 1) {Arabidopsis thaliana} Length = 283 Score = 110 bits (265), Expect = 8e-25 Identities = 48/86 (55%), Positives = 64/86 (74%) Frame = +2 Query: 350 WFTESCDMWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFSY 529 WF+E MWPG S +V++VL KS YQ++ VF + + GKVLVLDG+IQ T++DE +Y Sbjct: 47 WFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAY 106 Query: 530 QEMISFLPLCCHKNPENVLIVGGGDG 607 QEMI+ LPLC NP+ VL++GGGDG Sbjct: 107 QEMITHLPLCSIPNPKKVLVIGGGDG 132 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +1 Query: 622 EVAKHPQVKHIVLVEIDDRVIELSKRY 702 EVA+H ++ I + EID V+++SK++ Sbjct: 137 EVARHASIEQIDMCEIDKMVVDVSKQF 163 >At1g23820.1 68414.m03005 spermidine synthase 1 (SPDSYN1) / putrescine aminopropyltransferase 1 identical to SP|Q9ZUB3 Spermidine synthase 1 (EC 2.5.1.16) (Putrescine aminopropyltransferase 1) (SPDSY 1) {Arabidopsis thaliana} Length = 334 Score = 110 bits (265), Expect = 8e-25 Identities = 48/86 (55%), Positives = 64/86 (74%) Frame = +2 Query: 350 WFTESCDMWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFSY 529 WF+E MWPG S +V++VL KS YQ++ VF + + GKVLVLDG+IQ T++DE +Y Sbjct: 47 WFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAY 106 Query: 530 QEMISFLPLCCHKNPENVLIVGGGDG 607 QEMI+ LPLC NP+ VL++GGGDG Sbjct: 107 QEMITHLPLCSIPNPKKVLVIGGGDG 132 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +1 Query: 622 EVAKHPQVKHIVLVEIDDRVIELSKRY 702 EVA+H ++ I + EID V+++SK++ Sbjct: 137 EVARHASIEQIDMCEIDKMVVDVSKQF 163 >At5g53120.3 68418.m06603 spermidine synthase, putative / putrescine aminopropyltransferase, putative similar to SP|O82147 Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) (SPDSY) {Coffea arabica}; contains Pfam profile PF01564: Spermine/spermidine synthase Length = 359 Score = 105 bits (253), Expect = 2e-23 Identities = 46/79 (58%), Positives = 62/79 (78%) Frame = +2 Query: 371 MWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFSYQEMISFL 550 MWPG S +V++VL +KS +Q + VF++ + GKVLVLDGI+Q T+KDE +YQEMI+ L Sbjct: 77 MWPGEAHSLKVEKVLFKDKSDFQEVLVFESATYGKVLVLDGIVQLTEKDECAYQEMIAHL 136 Query: 551 PLCCHKNPENVLIVGGGDG 607 PLC +P+NVL+VGGGDG Sbjct: 137 PLCSISSPKNVLVVGGGDG 155 >At5g53120.2 68418.m06602 spermidine synthase, putative / putrescine aminopropyltransferase, putative similar to SP|O82147 Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) (SPDSY) {Coffea arabica}; contains Pfam profile PF01564: Spermine/spermidine synthase Length = 359 Score = 105 bits (253), Expect = 2e-23 Identities = 46/79 (58%), Positives = 62/79 (78%) Frame = +2 Query: 371 MWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFSYQEMISFL 550 MWPG S +V++VL +KS +Q + VF++ + GKVLVLDGI+Q T+KDE +YQEMI+ L Sbjct: 77 MWPGEAHSLKVEKVLFKDKSDFQEVLVFESATYGKVLVLDGIVQLTEKDECAYQEMIAHL 136 Query: 551 PLCCHKNPENVLIVGGGDG 607 PLC +P+NVL+VGGGDG Sbjct: 137 PLCSISSPKNVLVVGGGDG 155 >At5g53120.1 68418.m06601 spermidine synthase, putative / putrescine aminopropyltransferase, putative similar to SP|O82147 Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) (SPDSY) {Coffea arabica}; contains Pfam profile PF01564: Spermine/spermidine synthase Length = 359 Score = 105 bits (253), Expect = 2e-23 Identities = 46/79 (58%), Positives = 62/79 (78%) Frame = +2 Query: 371 MWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFSYQEMISFL 550 MWPG S +V++VL +KS +Q + VF++ + GKVLVLDGI+Q T+KDE +YQEMI+ L Sbjct: 77 MWPGEAHSLKVEKVLFKDKSDFQEVLVFESATYGKVLVLDGIVQLTEKDECAYQEMIAHL 136 Query: 551 PLCCHKNPENVLIVGGGDG 607 PLC +P+NVL+VGGGDG Sbjct: 137 PLCSISSPKNVLVVGGGDG 155 >At5g19530.1 68418.m02326 spermine/spermidine synthase family protein similar to SP|P09158 Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) {Escherichia coli}; contains Pfam profile PF01564: Spermine/spermidine synthase Length = 339 Score = 76.6 bits (180), Expect = 2e-14 Identities = 37/87 (42%), Positives = 53/87 (60%) Frame = +2 Query: 347 NWFTESCDMWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFS 526 +W+ E+ D +SF + VLH S+YQ+I + DT GKVLV+DG +Q ++DEF Sbjct: 34 HWYEETID--DDLKWSFALNSVLHQGTSEYQDIALLDTKRFGKVLVIDGKMQSAERDEFI 91 Query: 527 YQEMISFLPLCCHKNPENVLIVGGGDG 607 Y E + L H NP+ V I+GGG+G Sbjct: 92 YHECLIHPALLFHPNPKTVFIMGGGEG 118 Score = 27.9 bits (59), Expect = 6.9 Identities = 8/27 (29%), Positives = 18/27 (66%) Frame = +1 Query: 622 EVAKHPQVKHIVLVEIDDRVIELSKRY 702 E+ KH ++ +V+ +ID V++ +R+ Sbjct: 123 EILKHTTIEKVVMCDIDQEVVDFCRRF 149 >At2g04920.1 68415.m00513 F-box family protein (FBX9) identical to F-box protein family, AtFBX9 (GI:20197985) [Arabidopsis thaliana]; contains F-box domain PF:00646; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 376 Score = 31.1 bits (67), Expect = 0.74 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 392 SFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKD 517 S E K VL + S Y + QV+ + KV DG++ CT KD Sbjct: 75 SIEFKSVLSLKDSHYNSEQVY----IAKVFHCDGLLLCTTKD 112 >At4g14580.1 68417.m02244 CBL-interacting protein kinase 4 (CIPK4) identical to CBL-interacting protein kinase 4 [Arabidopsis thaliana] gi|13249503|gb|AAG01367; identical to cDNA calcineurin B-like (CBL) interacting protein kinase 4 (CIPK4) GI:13249502 Length = 426 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/67 (26%), Positives = 29/67 (43%) Frame = +2 Query: 344 TNWFTESCDMWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEF 523 T WF +S ++ + FE+ L E I FD SL L L G+ + ++ E Sbjct: 274 TVWFQKSLEISEFQSSVFELDRFLEKEAKSSNAITAFDLISLSSGLDLSGLFERRKRKEK 333 Query: 524 SYQEMIS 544 + +S Sbjct: 334 RFTARVS 340 >At4g11800.1 68417.m01879 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 1012 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = +2 Query: 350 WFTESCDMWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFSY 529 WF D GG S+ V ++L + F + G VL++ G + F+Y Sbjct: 369 WFDFMADTGDGGNSSYSVAKLLAQPSLRVPVANNFISLPRGNVLLIGGDLAYPNPSSFTY 428 Query: 530 QEMISFLP 553 ++ + F P Sbjct: 429 EKRL-FCP 435 >At3g04350.1 68416.m00460 expressed protein Length = 567 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 514 FLSALYDSVQDKNLPQTGCIKNLD 443 F YD ++ +P GC+KNLD Sbjct: 227 FFCCTYDLSSERTVPDIGCLKNLD 250 >At5g11300.1 68418.m01319 cyclin, putative (CYC3b) similar to cyclin 3a [Arabidopsis thaliana] GI:509425; contains Pfam profiles PF00134: Cyclin, N-terminal domain, PF02984: Cyclin, C-terminal domain; identical to cDNA cyc3b mRNA for cyclin 3b protein GI:728520 Length = 436 Score = 28.3 bits (60), Expect = 5.2 Identities = 28/112 (25%), Positives = 48/112 (42%), Gaps = 4/112 (3%) Frame = +1 Query: 55 PQKIYLSTN---RSLSRVSVCHMYRIISLDIYIVIVKCEFSNVEFVRRAKRVFIFRARNT 225 P +YL+ N R LS S R+ L + +++ ++ E F F NT Sbjct: 224 PDTLYLTVNLIDRFLSN-SYIERQRLQLLGVSCMLIASKYE--ELSAPGVEEFCFITANT 280 Query: 226 LFEREIVKTET*CQNLFNFRLQLPTWY*LLKQ-EKDGQTKNQLVYGIMRYVA 378 E++ E N +FRL +PT L++ K Q ++ + + Y+A Sbjct: 281 YTRPEVLSMEIQILNFVHFRLSVPTTKTFLRRFIKAAQASYKVPFIELEYLA 332 >At1g29900.1 68414.m03654 carbamoyl-phosphate synthase family protein similar to carbamoylphosphate synthetase GI:6552726 from [Medicago sativa]; contains Pfam profiles PF02786: Carbamoyl-phosphate synthase L chain ATP binding domain, PF00289: Carbamoyl-phosphate synthase L chain N-terminal domain, PF02787: Carbamoyl-phosphate synthetase large chain oligomerisation domain Length = 1187 Score = 27.9 bits (59), Expect = 6.9 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 3/79 (3%) Frame = +2 Query: 395 FEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFSYQEMISFLPLCCHKNP 574 F K++ K+ + ++ SLG V + C + E M S + C P Sbjct: 588 FSDKQIAFATKTTEEEVRT-KRISLGVVPSYKRVDTCAAEFEAHTPYMYSSYDVECESAP 646 Query: 575 EN---VLIVGGGDGRCRKG 622 N VLI+GGG R +G Sbjct: 647 NNKKKVLILGGGPNRIGQG 665 >At1g14460.1 68414.m01715 DNA polymerase-related weak similarity to DNA polymerase III holoenzyme tau subunit [Thermus thermophilus] GI:2583049 Length = 1116 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -3 Query: 251 VFTISRSNNVFLARNIKTRFALLTNSTLLNSHFT 150 V +I+ S + L RN++ R LL+ + LLNS T Sbjct: 925 VSSITNSIEMVLRRNVEVRIILLSETELLNSKQT 958 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,574,631 Number of Sequences: 28952 Number of extensions: 337774 Number of successful extensions: 863 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 863 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -