BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0369 (683 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29772| Best HMM Match : HEAT (HMM E-Value=1.54143e-44) 213 8e-56 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 119 3e-27 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 115 3e-26 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 113 2e-25 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 3e-25 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 2e-24 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 109 3e-24 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 8e-24 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 107 8e-24 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 2e-23 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 8e-23 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 9e-22 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 5e-21 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 2e-20 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 6e-20 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 8e-20 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 86 2e-17 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 5e-17 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 8e-15 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 2e-14 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) 71 7e-13 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 71 7e-13 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 70 2e-12 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 69 5e-12 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 69 5e-12 SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 8e-12 SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 8e-12 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 8e-12 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 68 8e-12 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 8e-12 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 67 1e-11 SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) 67 1e-11 SB_26951| Best HMM Match : CUB (HMM E-Value=0) 67 1e-11 SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) 67 1e-11 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_2571| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) 67 1e-11 SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_19262| Best HMM Match : Laminin_EGF (HMM E-Value=0.36) 67 1e-11 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 66 2e-11 SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) 66 2e-11 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 66 2e-11 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_47281| Best HMM Match : Adaptin_N (HMM E-Value=0) 66 2e-11 SB_39908| Best HMM Match : Prismane (HMM E-Value=3) 66 2e-11 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 66 2e-11 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 66 2e-11 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_24420| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) 66 3e-11 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 66 3e-11 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 65 4e-11 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 65 4e-11 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 65 4e-11 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 65 4e-11 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 65 4e-11 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 65 4e-11 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 65 4e-11 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 65 4e-11 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 65 4e-11 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 65 4e-11 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 65 4e-11 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 65 4e-11 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 65 4e-11 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 65 4e-11 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 65 4e-11 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 65 4e-11 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 65 4e-11 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 65 4e-11 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 65 4e-11 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 65 4e-11 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 65 4e-11 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 65 4e-11 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 65 4e-11 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 65 4e-11 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 65 4e-11 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 65 4e-11 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 65 4e-11 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 65 4e-11 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 65 4e-11 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 65 4e-11 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 65 4e-11 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 65 4e-11 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 65 4e-11 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 65 4e-11 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 65 4e-11 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 65 4e-11 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 65 4e-11 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 65 4e-11 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 65 4e-11 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 65 4e-11 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 65 4e-11 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 65 4e-11 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 65 4e-11 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 65 4e-11 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 65 4e-11 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 65 4e-11 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 65 4e-11 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 65 4e-11 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 65 4e-11 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 65 4e-11 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 65 4e-11 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 65 4e-11 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 65 4e-11 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 65 4e-11 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 65 4e-11 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 65 4e-11 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 65 4e-11 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 65 4e-11 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 65 4e-11 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 65 4e-11 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 65 4e-11 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 65 4e-11 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 >SB_29772| Best HMM Match : HEAT (HMM E-Value=1.54143e-44) Length = 405 Score = 213 bits (521), Expect = 8e-56 Identities = 104/151 (68%), Positives = 123/151 (81%) Frame = +1 Query: 37 DMEQHVMPTVRARAGDTSWRVRYMVADKFVELQQAVGPELARTDLAQIFQALLKDSEAEV 216 D + +MPTV++ A D SWRVRYMVADK ELQ+AVGPE+ +T+L FQ LLKD EAEV Sbjct: 148 DKDSILMPTVKSAAYDKSWRVRYMVADKITELQKAVGPEITKTELVPAFQVLLKDCEAEV 207 Query: 217 RAAAAGKVKDFCMNLDKAHQEHIIMTMILPQIKDLVCDANQHVKSALASVIMGLSPIVGR 396 RAAAAGKVK+F +L +E ++MT ILP +K+LV D NQHVKSALASVIMGLSP++G+ Sbjct: 208 RAAAAGKVKEFSESLSSDIRESVLMTNILPCVKELVIDPNQHVKSALASVIMGLSPLLGK 267 Query: 397 QNTIEHLLPLFLTQLKDECPEVRLNIISNLE 489 NTIEHLLPLFLT LKDE PEVRLNIISNL+ Sbjct: 268 DNTIEHLLPLFLTMLKDEFPEVRLNIISNLD 298 Score = 36.7 bits (81), Expect = 0.017 Identities = 21/78 (26%), Positives = 33/78 (42%) Frame = +1 Query: 10 CCGFSAGTRDMEQHVMPTVRARAGDTSWRVRYMVADKFVELQQAVGPELARTDLAQIFQA 189 C G + Q ++P + A DT WRVR + + L +G + L + + Sbjct: 299 CVNQVIGVHQLSQSLLPAIVELAEDTKWRVRLAIIEYMPLLAGQLGVDFFDEKLNTLCMS 358 Query: 190 LLKDSEAEVRAAAAGKVK 243 L D +R AAA +K Sbjct: 359 WLVDHVCSIREAAAINLK 376 Score = 32.7 bits (71), Expect = 0.28 Identities = 32/156 (20%), Positives = 63/156 (40%), Gaps = 4/156 (2%) Frame = +1 Query: 22 SAGTRDMEQHVMPTVRARAGDTSWRVRYMVADKFVELQQAVGPELAR----TDLAQIFQA 189 + G + ++P + D VR A K E +++ ++ T++ + Sbjct: 182 AVGPEITKTELVPAFQVLLKDCEAEVRAAAAGKVKEFSESLSSDIRESVLMTNILPCVKE 241 Query: 190 LLKDSEAEVRAAAAGKVKDFCMNLDKAHQEHIIMTMILPQIKDLVCDANQHVKSALASVI 369 L+ D V++A A + L K + ++ + L +KD + ++ S L V Sbjct: 242 LVIDPNQHVKSALASVIMGLSPLLGKDNTIEHLLPLFLTMLKDEFPEVRLNIISNLDCV- 300 Query: 370 MGLSPIVGRQNTIEHLLPLFLTQLKDECPEVRLNII 477 + ++G + LLP + +D VRL II Sbjct: 301 ---NQVIGVHQLSQSLLPAIVELAEDTKWRVRLAII 333 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 119 bits (286), Expect = 3e-27 Identities = 54/60 (90%), Positives = 55/60 (91%) Frame = -1 Query: 683 QAAQLLERAIGAGLFAITPAGERGMCCKAIKVG*RQGFPSHDVVKRRPVNCNTTHYRANW 504 QAAQLL RAIGAGLFAITPAGERGMCCKAIK+G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 8 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 115 bits (277), Expect = 3e-26 Identities = 52/60 (86%), Positives = 54/60 (90%) Frame = -1 Query: 683 QAAQLLERAIGAGLFAITPAGERGMCCKAIKVG*RQGFPSHDVVKRRPVNCNTTHYRANW 504 QAAQLL RAIGAGLFAITPAGERGMCCK+IK+ FPSHDVVKRRPVNCNTTHYRANW Sbjct: 2 QAAQLLGRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 113 bits (271), Expect = 2e-25 Identities = 53/65 (81%), Positives = 55/65 (84%) Frame = +3 Query: 489 GGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQ 668 GGA PIRPIVSRITIHWP+FYN TGKTLA NRLAAHPPFASWRNS+EAR DRP Q Sbjct: 36 GGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRPSQ 93 Query: 669 QLRSL 683 QLRSL Sbjct: 94 QLRSL 98 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 112 bits (269), Expect = 3e-25 Identities = 53/60 (88%), Positives = 54/60 (90%) Frame = -1 Query: 683 QAAQLLERAIGAGLFAITPAGERGMCCKAIKVG*RQGFPSHDVVKRRPVNCNTTHYRANW 504 QAAQLL RAIGAGLFAITPAGERGMCCKAIK+ FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1841 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLV-TPVFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 109 bits (262), Expect = 2e-24 Identities = 50/54 (92%), Positives = 50/54 (92%) Frame = +3 Query: 522 SRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 SRITIHWPSFYNVVTGKTLALPN LAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSL 55 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 109 bits (261), Expect = 3e-24 Identities = 49/59 (83%), Positives = 53/59 (89%) Frame = -1 Query: 683 QAAQLLERAIGAGLFAITPAGERGMCCKAIKVG*RQGFPSHDVVKRRPVNCNTTHYRAN 507 + AQLL R+IGAGLFAITPAGERGMCCKAIK+G +GFPSHD KRRPVNCNTTHYRAN Sbjct: 39 RVAQLLGRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 107 bits (257), Expect = 8e-24 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +3 Query: 522 SRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 SRITIHWPSFYNVVTGKTL++ NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 55 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 107 bits (257), Expect = 8e-24 Identities = 47/52 (90%), Positives = 48/52 (92%) Frame = -1 Query: 659 AIGAGLFAITPAGERGMCCKAIKVG*RQGFPSHDVVKRRPVNCNTTHYRANW 504 AIGAGLFAITPAGERGMCCKAIK+G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 2 AIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 107 bits (256), Expect = 1e-23 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = -3 Query: 678 CATVGKGDRCGPLRYYASWRKGDVLQGD*SWVTPGFSQSRRCKTTASEL 532 CATVGKGDRCGPLRYYASWRKGDVLQG SWVTPGFSQSRRCKTTASEL Sbjct: 2 CATVGKGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 106 bits (254), Expect = 2e-23 Identities = 50/61 (81%), Positives = 54/61 (88%), Gaps = 1/61 (1%) Frame = -1 Query: 683 QAAQLLERAIGAGLFAITPAGERGMCCKA-IKVG*RQGFPSHDVVKRRPVNCNTTHYRAN 507 QAAQLL RAIGAGLFAITPAGE+G + +K+G RQGFPSHDVVKRRPVNCNTTHYRAN Sbjct: 42 QAAQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRAN 101 Query: 506 W 504 W Sbjct: 102 W 102 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 104 bits (249), Expect = 8e-23 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -1 Query: 647 GLFAITPAGERGMCCKAIKVG*RQGFPSHDVVKRRPVNCNTTHYRANW 504 GLFAITPAGERGMCCKAIK+G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 12 GLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 678 CATVGKGDRCG 646 CATVGKGDRCG Sbjct: 2 CATVGKGDRCG 12 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 103 bits (248), Expect = 1e-22 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = +3 Query: 522 SRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 SRITIHWPSFYNVVTGKTLALPN L HPPFASWRNSEEARTDRP Q+LRSL Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSL 55 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 103 bits (246), Expect = 2e-22 Identities = 46/54 (85%), Positives = 47/54 (87%) Frame = +3 Query: 522 SRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 SRITIHWPSFYNVVTGK + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 55 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 103 bits (246), Expect = 2e-22 Identities = 46/54 (85%), Positives = 47/54 (87%) Frame = +3 Query: 522 SRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 SRITIHWPSFYNVVTGK + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 55 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 102 bits (244), Expect = 3e-22 Identities = 46/54 (85%), Positives = 47/54 (87%) Frame = +3 Query: 522 SRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 SRITIHWPSFYNVVTGK + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 55 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 100 bits (240), Expect = 9e-22 Identities = 47/54 (87%), Positives = 47/54 (87%) Frame = +3 Query: 522 SRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 SRITIHWPSFYNVVTGKTLALPN L PPFASWRNSEEARTDRP QQLRSL Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSL 55 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 98.3 bits (234), Expect = 5e-21 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = +3 Query: 537 HWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 HWPSFYNVVTGKTL + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 53 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 96.7 bits (230), Expect = 2e-20 Identities = 43/54 (79%), Positives = 46/54 (85%) Frame = +3 Query: 522 SRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 SRITIHWPSFYNV+ KT + NRLAAHPPFASWRNSE+ARTDRP QQLRSL Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSL 55 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 95.5 bits (227), Expect = 4e-20 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = -3 Query: 669 VGKGDRCGPLRYYASWRKGDVLQGD*SWVTPGFSQSRRCKTTASEL 532 +GKGDRCGPLRYYASWRKGDVLQ SWVTPGFSQSRRCKTTASEL Sbjct: 5 LGKGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 94.7 bits (225), Expect = 6e-20 Identities = 43/54 (79%), Positives = 45/54 (83%) Frame = +3 Query: 522 SRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 SRITIHWPSFYNVV + + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 55 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 94.3 bits (224), Expect = 8e-20 Identities = 42/50 (84%), Positives = 42/50 (84%) Frame = -3 Query: 681 GCATVGKGDRCGPLRYYASWRKGDVLQGD*SWVTPGFSQSRRCKTTASEL 532 GCATVGKGDRCGPLRYYASWRKGD S TPGFSQSRRCKTTASEL Sbjct: 30 GCATVGKGDRCGPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 92.3 bits (219), Expect = 3e-19 Identities = 43/59 (72%), Positives = 46/59 (77%) Frame = +3 Query: 507 IRPIVSRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 IRPIVSRITIHWPSFY + + NRLAAHPPFASWR+SEEARTDRP QQLR L Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEEARTDRPSQQLRRL 76 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 86.2 bits (204), Expect = 2e-17 Identities = 47/65 (72%), Positives = 47/65 (72%) Frame = +3 Query: 489 GGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQ 668 GGA PIRPIVS ITIHWPSFYN VT AHPPFASWRNSEEARTDRP Q Sbjct: 38 GGA--PIRPIVSHITIHWPSFYNGVT-------------AHPPFASWRNSEEARTDRPSQ 82 Query: 669 QLRSL 683 QLRSL Sbjct: 83 QLRSL 87 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 85.0 bits (201), Expect = 5e-17 Identities = 42/54 (77%), Positives = 43/54 (79%) Frame = +3 Query: 522 SRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 SRITIHWPSFYNVVTGKTLALPN L P +AS SEEARTDRP QQLRSL Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSL 55 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 82.2 bits (194), Expect = 4e-16 Identities = 41/59 (69%), Positives = 45/59 (76%) Frame = +3 Query: 507 IRPIVSRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 +RP+VSRITIHW SFYNVVTGKTLALPN L P + +EEARTDRP QQLRSL Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSL 91 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 81.8 bits (193), Expect = 5e-16 Identities = 42/67 (62%), Positives = 46/67 (68%) Frame = +3 Query: 483 PRGGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRP 662 PR A Y + +SRITIHWPS + + NRLAAHPPFASWRNSEEARTDRP Sbjct: 267 PRSMADYWMA--LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 324 Query: 663 FQQLRSL 683 QQLRSL Sbjct: 325 SQQLRSL 331 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 81.8 bits (193), Expect = 5e-16 Identities = 41/54 (75%), Positives = 42/54 (77%) Frame = +3 Query: 522 SRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 SRITIHWPSFYNVVTGKTLALPN L P + NSEEARTDRP QQLRSL Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSL 55 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 81.8 bits (193), Expect = 5e-16 Identities = 36/44 (81%), Positives = 37/44 (84%) Frame = -3 Query: 663 KGDRCGPLRYYASWRKGDVLQGD*SWVTPGFSQSRRCKTTASEL 532 +GDRCGPLRYYASWRKG SWVTPGFSQSRRCKTTASEL Sbjct: 67 QGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 81.0 bits (191), Expect = 8e-16 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = +3 Query: 552 YNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 YNVVTGKT + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 12 YNVVTGKTPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 55 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 81.0 bits (191), Expect = 8e-16 Identities = 40/57 (70%), Positives = 43/57 (75%) Frame = +3 Query: 513 PIVSRITIHWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 P +SRITIHWPSFYNVVTGKTLALPN L P + + EEARTDRP QQLRSL Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSL 133 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 79.0 bits (186), Expect = 3e-15 Identities = 40/55 (72%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = +3 Query: 522 SRITIHWPSFYNVVTGKTLAL-PNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 SRITIHWPSFYNVVTGK P+ L P ASWRNSEEARTDRP QQLRSL Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNSEEARTDRPSQQLRSL 56 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 77.8 bits (183), Expect = 8e-15 Identities = 35/45 (77%), Positives = 36/45 (80%) Frame = +3 Query: 537 HWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQ 671 HWPSFYN VTGKTLALPN L P FASWRNS+EARTDRP QQ Sbjct: 5 HWPSFYNDVTGKTLALPNLIALQHIPTFASWRNSQEARTDRPSQQ 49 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 76.2 bits (179), Expect = 2e-14 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = +3 Query: 537 HWPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 HWPSFYNVVTGKTLALPN L P + RNSEEARTDRP QQLRSL Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSL 53 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 73.7 bits (173), Expect = 1e-13 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = -1 Query: 620 ERGMCCKAIKVG*RQGFPSHDVVKRRPVNCNTTHYRAN 507 ERGMCCKAIK+G F SHDVVKRRPVNCNTTHYRAN Sbjct: 3 ERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) Length = 272 Score = 71.3 bits (167), Expect = 7e-13 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 681 GCATVGKGDRCGPLRYYASWRKGDVLQGD 595 GCATVGKGDRCGPLRYYASWRKGDVLQGD Sbjct: 244 GCATVGKGDRCGPLRYYASWRKGDVLQGD 272 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 71.3 bits (167), Expect = 7e-13 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 681 GCATVGKGDRCGPLRYYASWRKGDVLQGD 595 GCATVGKGDRCGPLRYYASWRKGDVLQGD Sbjct: 90 GCATVGKGDRCGPLRYYASWRKGDVLQGD 118 Score = 64.9 bits (151), Expect = 6e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRL 593 RLRNCW+GRSVRASSLLRQLAKGGCAARRL Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRL 52 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 591 SWVTPGFSQSRRCKTTAS 538 SWVTPGFSQSRRCKTTAS Sbjct: 53 SWVTPGFSQSRRCKTTAS 70 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 70.9 bits (166), Expect = 9e-13 Identities = 33/59 (55%), Positives = 40/59 (67%) Frame = -1 Query: 680 AAQLLERAIGAGLFAITPAGERGMCCKAIKVG*RQGFPSHDVVKRRPVNCNTTHYRANW 504 A QL+ R A + A TP+G++ M ++ FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1 AEQLIPRETVAVVLATTPSGDKSMYSESNNKSHAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 69.7 bits (163), Expect = 2e-12 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 683 QAAQLLERAIGAGLFAITPAGERGMCCKAIKVG*RQGFP 567 QAAQLL RAIGAGLFAITPAGERGMCCKAIK+G + FP Sbjct: 15 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFP 53 Score = 32.7 bits (71), Expect = 0.28 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 661 GRSVRASSL-LRQLAKGGCAARRLKLGNARVFPVTT 557 GR++ A + + G + +KLGNARVFPVTT Sbjct: 21 GRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTT 56 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 68.5 bits (160), Expect = 5e-12 Identities = 35/47 (74%), Positives = 39/47 (82%), Gaps = 3/47 (6%) Frame = -1 Query: 683 QAAQLLERAIGAGLFAITPAGERGMCCKAIKVG---*RQGFPSHDVV 552 QAAQLL RAIGAGLFAITPAGERGMCCKAIK+G + G P++ VV Sbjct: 124 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGLDVPKHGEPAYPVV 170 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 68.5 bits (160), Expect = 5e-12 Identities = 39/71 (54%), Positives = 43/71 (60%), Gaps = 7/71 (9%) Frame = +3 Query: 492 GARYPIRPIVSRITIHWPSFYNVVT-------GKTLALPNFNRLAAHPPFASWRNSEEAR 650 G YP P SR H S+YN + + + NRLAAHPPFASWRNSEEAR Sbjct: 42 GLNYPFVPKSSR---HSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 98 Query: 651 TDRPFQQLRSL 683 TDRP QQLRSL Sbjct: 99 TDRPSQQLRSL 109 >SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 68.1 bits (159), Expect = 6e-12 Identities = 39/82 (47%), Positives = 46/82 (56%), Gaps = 14/82 (17%) Frame = +3 Query: 480 QPRGGARYPIRPIVSRITIHWPS-------FYNVVT-------GKTLALPNFNRLAAHPP 617 +P+ G R PI + R W S +YN + + + NRLAAHPP Sbjct: 44 EPKNGQRAPINDFLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPP 103 Query: 618 FASWRNSEEARTDRPFQQLRSL 683 FASWRNSEEARTDRP QQLRSL Sbjct: 104 FASWRNSEEARTDRPSQQLRSL 125 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 67.7 bits (158), Expect = 8e-12 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +3 Query: 567 GKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 G+ + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 38 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 34.7 bits (76), Expect = 0.071 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRD EN GVTQL + PF Sbjct: 29 LAVVLQRRDGENTGVTQLNRLAAHPPF 55 >SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 67.7 bits (158), Expect = 8e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 683 QAAQLLERAIGAGLFAITPAGERGMCCKAIKVG*R 579 QAAQLL RAIGAGLFAITPAGERGMCCKAIK+G R Sbjct: 8 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGIR 42 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 67.7 bits (158), Expect = 8e-12 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +3 Query: 567 GKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 G+ + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 63 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 101 Score = 34.7 bits (76), Expect = 0.071 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRD EN GVTQL + PF Sbjct: 54 LAVVLQRRDGENTGVTQLNRLAAHPPF 80 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 67.7 bits (158), Expect = 8e-12 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +3 Query: 567 GKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 G+ + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 704 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 742 Score = 34.7 bits (76), Expect = 0.071 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRD EN GVTQL + PF Sbjct: 695 LAVVLQRRDGENTGVTQLNRLAAHPPF 721 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 67.7 bits (158), Expect = 8e-12 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +3 Query: 567 GKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 G+ + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 75 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 113 Score = 34.7 bits (76), Expect = 0.071 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRD EN GVTQL + PF Sbjct: 66 LAVVLQRRDGENTGVTQLNRLAAHPPF 92 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 67.3 bits (157), Expect = 1e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 683 QAAQLLERAIGAGLFAITPAGERGMCCKAIKVG 585 QAAQLL RAIGAGLFAITPAGERGMCCKAIK+G Sbjct: 1950 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLG 1982 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 67.3 bits (157), Expect = 1e-11 Identities = 34/57 (59%), Positives = 39/57 (68%), Gaps = 7/57 (12%) Frame = +3 Query: 534 IHWPSFYNVVT-------GKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 IH+ S+YN + + + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 1464 IHYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 1520 >SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) Length = 340 Score = 67.3 bits (157), Expect = 1e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 683 QAAQLLERAIGAGLFAITPAGERGMCCKAIKVG 585 QAAQLL RAIGAGLFAITPAGERGMCCKAIK+G Sbjct: 8 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLG 40 >SB_26951| Best HMM Match : CUB (HMM E-Value=0) Length = 794 Score = 67.3 bits (157), Expect = 1e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 683 QAAQLLERAIGAGLFAITPAGERGMCCKAIKVG 585 QAAQLL RAIGAGLFAITPAGERGMCCKAIK+G Sbjct: 8 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLG 40 >SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) Length = 799 Score = 67.3 bits (157), Expect = 1e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 683 QAAQLLERAIGAGLFAITPAGERGMCCKAIKVG 585 QAAQLL RAIGAGLFAITPAGERGMCCKAIK+G Sbjct: 8 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLG 40 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 67.3 bits (157), Expect = 1e-11 Identities = 34/60 (56%), Positives = 41/60 (68%), Gaps = 3/60 (5%) Frame = +3 Query: 513 PIVSRITIHWPSFYNVVTGKTLALPN---FNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 P++ R+ ++ S V+ + P NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 109 >SB_2571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 67.3 bits (157), Expect = 1e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 683 QAAQLLERAIGAGLFAITPAGERGMCCKAIKVG 585 QAAQLL RAIGAGLFAITPAGERGMCCKAIK+G Sbjct: 232 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLG 264 >SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) Length = 282 Score = 66.9 bits (156), Expect = 1e-11 Identities = 30/48 (62%), Positives = 32/48 (66%) Frame = +3 Query: 540 WPSFYNVVTGKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 WPS YN + NRL AH PF SWRNSEEARTDRP QQ+RSL Sbjct: 218 WPSIYNDRDWNNSGVTQLNRLVAHLPFVSWRNSEEARTDRPSQQMRSL 265 >SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 66.9 bits (156), Expect = 1e-11 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = +3 Query: 570 KTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 K + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 18 KNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 55 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDW+N GVTQL + PF Sbjct: 8 LAVVLQRRDWKNTGVTQLNRLAAHPPF 34 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 66.9 bits (156), Expect = 1e-11 Identities = 32/38 (84%), Positives = 32/38 (84%) Frame = +1 Query: 568 GKPWRYPTLIALQHIPLSPAGVIAKRPAPIALSNSCAA 681 GK P LIALQHIPLSPAGVIAKRPAPIAL NSCAA Sbjct: 72 GKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAA 109 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +3 Query: 537 HWPSFYNVVTGKTLALPNFNRLAAHP 614 HWPSFYNVVTGKTLALPN L P Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIP 87 >SB_19262| Best HMM Match : Laminin_EGF (HMM E-Value=0.36) Length = 1173 Score = 66.9 bits (156), Expect = 1e-11 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRLKLGNA 578 RLRNCW+GRSVRASSLLRQLAKGGCAARRL N+ Sbjct: 76 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWANS 110 >SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 66.9 bits (156), Expect = 1e-11 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +3 Query: 567 GKTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 G+ + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 38 GENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRD ENPGVTQL + PF Sbjct: 29 LAVVLQRRDGENPGVTQLNRLAAHPPF 55 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 66.9 bits (156), Expect = 1e-11 Identities = 32/38 (84%), Positives = 32/38 (84%) Frame = +1 Query: 568 GKPWRYPTLIALQHIPLSPAGVIAKRPAPIALSNSCAA 681 GK P LIALQHIPLSPAGVIAKRPAPIAL NSCAA Sbjct: 67 GKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAA 104 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +3 Query: 537 HWPSFYNVVTGKTLALPNFNRLAAHP 614 HWPSFYNVVTGKTLALPN L P Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIP 82 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRLKLG 584 RLRNCW+GRSVRASSLLRQLAKGGCAARRL G Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 55 Score = 34.3 bits (75), Expect = 0.093 Identities = 21/49 (42%), Positives = 27/49 (55%) Frame = -1 Query: 575 GFPSHDVVKRRPVNCNTTHYRANWVPGPPSRLEIMLSRTSGHSSFSCVR 429 GFPSHDVVKRRPV + H + + P LE +L +S +C R Sbjct: 55 GFPSHDVVKRRPV--PSLHACRSTLEDPREDLEYILESVEKLNS-TCAR 100 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRLKLG 584 RLRNCW+GRSVRASSLLRQLAKGGCAARRL G Sbjct: 408 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 440 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 1208 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 1237 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHPPF 1216 >SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) Length = 912 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRLKLG 584 RLRNCW+GRSVRASSLLRQLAKGGCAARRL G Sbjct: 36 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 68 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRLKLG 584 RLRNCW+GRSVRASSLLRQLAKGGCAARRL G Sbjct: 593 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 625 Score = 61.7 bits (143), Expect = 5e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 575 GFPSHDVVKRRPVNCNTTHYRANW 504 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 625 GFPSHDVVKRRPVNCNTTHYRANW 648 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRLKLG 584 RLRNCW+GRSVRASSLLRQLAKGGCAARRL G Sbjct: 623 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 655 >SB_47281| Best HMM Match : Adaptin_N (HMM E-Value=0) Length = 949 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRLKLG 584 RLRNCW+GRSVRASSLLRQLAKGGCAARRL G Sbjct: 75 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 107 Score = 64.9 bits (151), Expect = 6e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRL 593 RLRNCW+GRSVRASSLLRQLAKGGCAARRL Sbjct: 399 RLRNCWEGRSVRASSLLRQLAKGGCAARRL 428 >SB_39908| Best HMM Match : Prismane (HMM E-Value=3) Length = 456 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRLKLG 584 RLRNCW+GRSVRASSLLRQLAKGGCAARRL G Sbjct: 325 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 357 Score = 65.3 bits (152), Expect = 4e-11 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -1 Query: 683 QAAQLLERAIGAGLFAITPAGERGMCCKAIKVG*RQG 573 QAAQLL RAIGAGLFAITPAGERGMCCKAIK+ +G Sbjct: 8 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLAKLRG 44 >SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 66.5 bits (155), Expect = 2e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 678 CATVGKGDRCGPLRYYASWRKGDVLQG 598 CATVGKGDRCGPLRYYASWRKGDVLQG Sbjct: 63 CATVGKGDRCGPLRYYASWRKGDVLQG 89 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 679 LRNCWKGRSVRASSLLRQLAKGGCAARRL 593 LRNCW+GRSVRASSLLRQLAKGGCAARRL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRL 30 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 591 SWVTPGFSQSRRCKTTAS 538 SWVTPGFSQSRRCKTTAS Sbjct: 31 SWVTPGFSQSRRCKTTAS 48 >SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRLKLG 584 RLRNCW+GRSVRASSLLRQLAKGGCAARRL G Sbjct: 211 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 243 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRLKLG 584 RLRNCW+GRSVRASSLLRQLAKGGCAARRL G Sbjct: 36 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 68 Score = 61.7 bits (143), Expect = 5e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 575 GFPSHDVVKRRPVNCNTTHYRANW 504 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRLKLG 584 RLRNCW+GRSVRASSLLRQLAKGGCAARRL G Sbjct: 36 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 68 Score = 61.7 bits (143), Expect = 5e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 575 GFPSHDVVKRRPVNCNTTHYRANW 504 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 66.1 bits (154), Expect = 2e-11 Identities = 47/115 (40%), Positives = 56/115 (48%), Gaps = 3/115 (2%) Frame = +3 Query: 348 VCPSLRHHGPEPHSGQTEHY*TSPAAVPHTTEG*MSRSPTQHNLQPRGGARYPIRPIVSR 527 V P L +G EH TS ++P TE S + R R+ S Sbjct: 405 VNPDLHAKNNNVRTG-VEHESTSSTSIPQVTEHQPSIEVKAEQVLERPPPRWSSNSPYSE 463 Query: 528 ITIHWPSFYNVVTGKTLALPN---FNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 ++ S V+ + P NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 464 S--YYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 516 >SB_24420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 608 Score = 66.1 bits (154), Expect = 2e-11 Identities = 35/43 (81%), Positives = 36/43 (83%), Gaps = 4/43 (9%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRLK---LGNA-RVFP 566 RLRNCW+GRSVRASSLLRQLAKGGCAARRL L NA R FP Sbjct: 78 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWLALQNALRYFP 120 >SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) Length = 857 Score = 65.7 bits (153), Expect = 3e-11 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -2 Query: 682 RLRNCWKGRSVRASSLLRQLAKGGCAARRLKLGNA 578 RLRNCW+GRSVRASSLLRQLAKGGCAARRL A Sbjct: 630 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWSTA 664 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 65.7 bits (153), Expect = 3e-11 Identities = 40/86 (46%), Positives = 49/86 (56%), Gaps = 9/86 (10%) Frame = +3 Query: 453 SRSPTQHNLQPRGG--ARYPIRPIVSRITIHWPSFYNVVT-------GKTLALPNFNRLA 605 SR P LQP G +R + + ++ S+YN + + + NRLA Sbjct: 106 SRGPNIEFLQPGGSTSSRAAATAVELQFALY-ESYYNSLAVVLQRRDWENPGVTQLNRLA 164 Query: 606 AHPPFASWRNSEEARTDRPFQQLRSL 683 AHPPFASWRNSEEARTDRP QQLRSL Sbjct: 165 AHPPFASWRNSEEARTDRPSQQLRSL 190 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 65.7 bits (153), Expect = 3e-11 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 7/55 (12%) Frame = +3 Query: 540 WPSFYNVVTG-------KTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 + S+YN + G + + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 45 YESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 99 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 3e-11 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 7/55 (12%) Frame = +3 Query: 540 WPSFYNVVTG-------KTLALPNFNRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 + S+YN + G + + NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 58 YESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 112 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 53 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 82 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPF 61 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 33 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 62 Score = 36.7 bits (81), Expect = 0.017 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +2 Query: 551 LQRRDWENPGVTQL*SPCSTSPF 619 LQRRDWENPGVTQL + PF Sbjct: 19 LQRRDWENPGVTQLNRLAAHPPF 41 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 80 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 109 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPF 88 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 62 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 91 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPF 70 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 54 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 83 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPF 62 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 80 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 109 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPF 88 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 60 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 89 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWEN GVTQL + PF Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHPPF 68 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 85 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 114 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPF 93 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 56 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 85 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPF 64 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 76 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 105 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPF 84 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 88 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 117 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPF 96 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 64 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 93 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPF 72 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 53 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 82 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPF 61 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 43 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 72 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPF 51 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 68 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 97 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPF 76 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 77 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 106 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPF 85 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 71 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 100 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPF 79 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 87 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 116 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPF 95 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 75 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 104 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPF 83 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 58 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 87 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPF 66 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWEN GVTQL + PF Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPF 55 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 58 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 87 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +2 Query: 557 RRDWENPGVTQL*SPCSTSPF 619 RRDWENPGVTQL + PF Sbjct: 46 RRDWENPGVTQLNRLAAHPPF 66 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 234 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 263 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPF 242 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 129 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 158 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPF 137 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 67 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 96 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPF 75 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 46 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 75 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPF 54 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 34 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 65 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 94 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPF 73 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 399 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 428 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPF 407 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 125 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 154 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPF 133 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 101 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 130 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPF 109 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 57 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 86 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPF 65 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 26 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 55 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPF 34 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 36 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 65 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPF 44 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 56 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 85 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPF 64 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 121 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 150 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPF 129 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 63 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 92 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPF 71 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 358 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 387 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPF 366 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 98 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 127 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPF 106 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 68 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 97 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPF 76 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 34 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 77 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 106 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPF 85 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 61 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 90 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPF 69 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 152 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 181 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPF 160 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 81 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 110 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPF 89 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 57 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 86 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPF 65 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 851 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 880 Score = 44.4 bits (100), Expect = 9e-05 Identities = 30/71 (42%), Positives = 35/71 (49%) Frame = +2 Query: 407 LNISCRCSSHN*RMNVPKSDST*SPTSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVT 586 L I R +H + K+ S SRG P+ LAVVLQRRDWENPGVT Sbjct: 791 LPILARKLAHLNSLQYVKASSWFYKPSRGDPLESTCRHASLA--LAVVLQRRDWENPGVT 848 Query: 587 QL*SPCSTSPF 619 QL + PF Sbjct: 849 QLNRLAAHPPF 859 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 34 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 78 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 107 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPF 86 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 52 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 81 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPF 60 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 91 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 120 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPF 99 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 53 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 82 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWEN GVTQL + PF Sbjct: 35 LAVVLQRRDWENTGVTQLNRLAAHPPF 61 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 74 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 103 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPF 82 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 87 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 116 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPF 95 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 83 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 112 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQR DWENPGVTQL + PF Sbjct: 65 LAVVLQRLDWENPGVTQLNRLAAHPPF 91 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 274 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 303 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHPPF 282 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWEN GVTQL + PF Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPF 55 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 132 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 161 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPF 140 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 68 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 97 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPF 76 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 54 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 83 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPF 62 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 55 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 84 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPF 63 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 119 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 148 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHPPF 127 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 132 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 161 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPF 140 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 57 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 86 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPF 65 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 38 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 67 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPF 46 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 76 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 105 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPF 84 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 55 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 84 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPF 63 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 52 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 81 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPF 60 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 29 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 58 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPF 37 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 37 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 66 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPF 45 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 414 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 443 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHPPF 422 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 63 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 92 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPF 71 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 72 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 101 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPF 80 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 54 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 83 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPF 62 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 137 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 166 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPF 145 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 73 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 102 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPF 81 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 83 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 112 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPF 91 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 86 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 115 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPF 94 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 432 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 461 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHPPF 440 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 129 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 158 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPF 137 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 85 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 114 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPF 93 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 74 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 103 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPF 82 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 64 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 93 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPF 72 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWEN GVTQL + PF Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPF 55 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 179 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 208 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPF 187 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 83 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 112 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPF 91 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 70 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 99 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPF 78 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 106 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 135 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPF 114 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 72 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 101 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWEN GVTQL + PF Sbjct: 54 LAVVLQRRDWENTGVTQLNRLAAHPPF 80 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 55 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 84 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPF 63 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 81 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 110 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPF 89 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 60 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 89 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPF 68 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 203 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 232 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPF 211 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 52 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 81 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPF 60 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 58 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 87 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPF 66 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 72 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 101 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPF 80 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 69 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 98 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPF 77 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 52 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 81 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPF 60 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 53 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 82 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPF 61 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 67 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 96 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPF 75 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 57 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 86 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPF 65 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 150 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 179 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPF 158 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 59 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 88 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPF 67 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 102 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 131 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPF 110 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 40 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 69 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPF 48 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 171 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 200 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPF 179 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 358 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 387 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPF 366 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWEN GVTQL + PF Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPF 55 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 108 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 137 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWEN GVTQL + PF Sbjct: 90 LAVVLQRRDWENTGVTQLNRLAAHPPF 116 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 75 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 104 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPF 83 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 39 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 68 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPF 47 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 65 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 94 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 L VVLQRRDWENPGVTQL + PF Sbjct: 47 LDVVLQRRDWENPGVTQLNRLAAHPPF 73 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 127 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 156 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPF 135 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 104 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 133 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPF 112 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 54 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 83 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPF 62 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 78 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 107 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPF 86 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 312 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 341 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 294 LAVVLQRRDWENPGVTQLNRLAAHPPF 320 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 75 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 104 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPF 83 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 76 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 105 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPF 84 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 34 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 54 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 83 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPF 62 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 429 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 458 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 411 LAVVLQRRDWENPGVTQLNRLAAHPPF 437 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 113 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 142 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 95 LAVVLQRRDWENPGVTQLNRLAAHPPF 121 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 69 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 98 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPF 77 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 61 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 90 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPF 69 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWEN GVTQL + PF Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPF 55 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 60 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 89 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWEN GVTQL + PF Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHPPF 68 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 111 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 140 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPF 119 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 61 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 90 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPF 69 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 229 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 258 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 211 LAVVLQRRDWENPGVTQLNRLAAHPPF 237 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 61 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 90 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPF 69 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 231 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 260 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPF 239 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 51 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 80 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPF 59 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 66 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 95 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPF 74 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 56 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 85 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPF 64 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 61 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 90 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPF 69 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 165 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 194 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 147 LAVVLQRRDWENPGVTQLNRLAAHPPF 173 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 69 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 98 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWEN GVTQL + PF Sbjct: 51 LAVVLQRRDWENTGVTQLNRLAAHPPF 77 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 63 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 92 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPF 71 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 53 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 82 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPF 61 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 73 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 102 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPF 81 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 58 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 87 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPF 66 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 93 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 122 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPF 101 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 213 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 242 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 195 LAVVLQRRDWENPGVTQLNRLAAHPPF 221 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 70 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 99 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWEN GVTQL + PF Sbjct: 52 LAVVLQRRDWENTGVTQLNRLAAHPPF 78 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 71 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 100 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPF 79 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 50 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 79 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPF 58 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 104 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 133 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPF 112 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 594 NRLAAHPPFASWRNSEEARTDRPFQQLRSL 683 NRLAAHPPFASWRNSEEARTDRP QQLRSL Sbjct: 40 NRLAAHPPFASWRNSEEARTDRPSQQLRSL 69 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 539 LAVVLQRRDWENPGVTQL*SPCSTSPF 619 LAVVLQRRDWENPGVTQL + PF Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPF 48 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,853,679 Number of Sequences: 59808 Number of extensions: 497131 Number of successful extensions: 8623 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8584 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -