BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0360 (781 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46433| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_3024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_8818| Best HMM Match : I-set (HMM E-Value=0) 28 9.8 >SB_46433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 29.1 bits (62), Expect = 4.2 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Frame = +1 Query: 58 LLTVAITYWHTLARV*CALTLTLAIAFPQSSCFKVFNRTSASAR*LVPTHRSD-PRIILN 234 +L VA+ YW TLA V + + L F Q S F+ +S R V +H + + +++ Sbjct: 640 ILCVAVNYWVTLAAVPLLVVVVLLKRFAQRS-FRDLRSLESSLRTPVNSHLVETAQGLIS 698 Query: 235 VREQSGR*LFVGAAI 279 +R R F +I Sbjct: 699 IRAYRSRNTFQNCSI 713 >SB_3024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 28.3 bits (60), Expect = 7.4 Identities = 22/57 (38%), Positives = 28/57 (49%) Frame = +3 Query: 180 ISALAGAYTPL*PSNYPECSRTVRALVVCWRRYSPRDGVSCRQQ*STVPDVKCCTST 350 +SAL G Y PL + SR V + WR SP GV CR++ D+ C ST Sbjct: 401 VSALCGGYMPL-NAFVGFVSRQVDKICQ-WRFVSPLCGVICREK-----DLSICQST 450 >SB_8818| Best HMM Match : I-set (HMM E-Value=0) Length = 2787 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 684 DRKIKKNERTVSTTKAQKCILFI 616 D+ IKK +R +TTK +C+L + Sbjct: 256 DKPIKKTDRLTTTTKDDECVLVL 278 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,803,320 Number of Sequences: 59808 Number of extensions: 423127 Number of successful extensions: 778 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -