BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0360 (781 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 24 1.4 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 24 1.4 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 4.2 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 22 5.6 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 22 5.6 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 22 5.6 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 149 DDCGKAIANVNVSAHYTRASVCQYVMATV 63 D CG+ +N S H+ RAS+ M+ + Sbjct: 23 DTCGRDTYALNQSLHFVRASLSNLDMSVL 51 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 149 DDCGKAIANVNVSAHYTRASVCQYVMATV 63 D CG+ +N S H+ RAS+ M+ + Sbjct: 113 DTCGRDTYALNQSLHFVRASLSNLDMSVL 141 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -1 Query: 376 VVANRFFTKVDVQHLTSGTVLYCWRQLTPS 287 + + F QHL +Y W++L PS Sbjct: 610 IALSEFVINPHQQHLDQWNWVYEWKELIPS 639 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 328 SGTVLYCWRQLTPSL 284 SGT L CW Q SL Sbjct: 235 SGTALNCWTQTENSL 249 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 328 SGTVLYCWRQLTPSL 284 SGT L CW Q SL Sbjct: 106 SGTALNCWTQTENSL 120 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 328 SGTVLYCWRQLTPSL 284 SGT L CW Q SL Sbjct: 235 SGTALNCWTQTENSL 249 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,991 Number of Sequences: 438 Number of extensions: 4087 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24518154 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -