BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0359 (711 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 23 2.9 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 23 2.9 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 23 2.9 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 23 2.9 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 23 3.8 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 23 3.8 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 23 3.8 AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. 21 8.7 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 356 YLFLYMYINYDSQFNYNLYYIQTI 285 Y + Y NY+ + YN+ YI+ I Sbjct: 95 YKYNYNNNNYNKKLYYNINYIEQI 118 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 356 YLFLYMYINYDSQFNYNLYYIQTI 285 Y + Y NY+ + YN+ YI+ I Sbjct: 95 YKYNYNNNNYNKKLYYNINYIEQI 118 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 356 YLFLYMYINYDSQFNYNLYYIQTI 285 Y + Y NY+ + YN+ YI+ I Sbjct: 95 YKYNYNNNNYNKKLYYNINYIEQI 118 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 356 YLFLYMYINYDSQFNYNLYYIQTI 285 Y + Y NY+ + YN+ YI+ I Sbjct: 95 YKYNYNNNNYNKKLYYNINYIEQI 118 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 338 YINYDSQFNYNLYYIQTI 285 Y NY+ + YN+ YI+ I Sbjct: 101 YNNYNKKLYYNINYIEQI 118 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 22.6 bits (46), Expect = 3.8 Identities = 10/18 (55%), Positives = 12/18 (66%), Gaps = 2/18 (11%) Frame = -2 Query: 344 YMYINYDSQFNYN--LYY 297 Y Y NY++ NYN LYY Sbjct: 89 YKYSNYNNYNNYNKKLYY 106 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.6 bits (46), Expect = 3.8 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -1 Query: 324 LTIQLQLVLYTNNLIILKYKFQYISIKSLLL 232 +T++ + + YT NLI+ Y+S+ + L Sbjct: 229 ITLRRKTLFYTVNLIVPCVSISYLSVLAFYL 259 >AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. Length = 126 Score = 21.4 bits (43), Expect = 8.7 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 107 TDRNVRSKCRCSNVSCSSHYDAQLTAFFIDP 15 TDR +R+K V C A + + + DP Sbjct: 74 TDRVIRAKLGKVGVHCMKTTQAVVVSLYEDP 104 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,707 Number of Sequences: 438 Number of extensions: 3699 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -