BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0357 (715 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 23 3.3 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 4.3 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 22 5.7 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 22.6 bits (46), Expect = 3.3 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 158 NIGSLRVVCFGRSRCHRSSGIEIH-SLPDL 72 N+G L + FGRSR R + H +L DL Sbjct: 42 NVGVLYTLLFGRSRKSRMNYFITHLALADL 71 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.2 bits (45), Expect = 4.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 649 QHDILNASAEAAADAGVRVHYH 584 QH +L +A AAA V + YH Sbjct: 174 QHGLLLTAAVAAAGPSVDLSYH 195 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 327 DPVRNLVGGVYGLT 286 DPV N + GVY +T Sbjct: 447 DPVTNEIKGVYNMT 460 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,670 Number of Sequences: 336 Number of extensions: 2993 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -