BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0355 (729 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 3.3 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 22 4.4 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 7.7 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = -3 Query: 154 LYKIYHKYVWFFCTLNNLMR*RLLVGVS 71 +Y++YH + + CT N R +++ +S Sbjct: 248 IYEMYHLAILWSCTSTNCPRFLIMLALS 275 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 22.2 bits (45), Expect = 4.4 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -1 Query: 168 VLLNNCIKFIINTFGFFAP*II*CDEDCSWACLTYISF 55 +LL + F+I T F ++ E W L YISF Sbjct: 244 LLLMFAVSFLIITQVIFVICVLVQSEKIVWLHLVYISF 281 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 658 VSGFYFHFILVDIANLCDHEY 720 + FYF F+L + LC Y Sbjct: 134 MKNFYFWFVLKQVMFLCYSTY 154 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,153 Number of Sequences: 336 Number of extensions: 3416 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -