BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0354 (748 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0003 - 13992276-13992311,13992461-13992598,13992682-139928... 29 5.2 10_08_0066 + 14610220-14610798,14610928-14611287 28 9.1 >10_08_0003 - 13992276-13992311,13992461-13992598,13992682-13992852, 13992926-13992989,13993404-13993552,13993700-13993753, 13993894-13994034,13994134-13994412,13994518-13994743, 13995328-13995734 Length = 554 Score = 28.7 bits (61), Expect = 5.2 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -1 Query: 121 AIQSLSHLLRHPKRGGGAFV 62 A+Q++S +L P+RGGG F+ Sbjct: 17 AVQTISRVLSFPRRGGGGFL 36 >10_08_0066 + 14610220-14610798,14610928-14611287 Length = 312 Score = 27.9 bits (59), Expect = 9.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 98 KMTKGLDGGDILSIIPVASIRKCHYSVNSCRE 193 K++K +D G + +I+ +A CH +C E Sbjct: 243 KLSKHIDAGSVANILALAEQHSCHTLKEACLE 274 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,718,483 Number of Sequences: 37544 Number of extensions: 321512 Number of successful extensions: 685 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 671 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 685 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -