BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0354 (748 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55020.1 68416.m06110 RabGAP/TBC domain-containing protein lo... 28 7.6 At1g30780.1 68414.m03763 F-box family protein 27 10.0 >At3g55020.1 68416.m06110 RabGAP/TBC domain-containing protein low similarity to SP|Q9BXI6 EBP50-PDZ interactor of 64 kDa (EPI64 protein) {Homo sapiens}; contains Pfam profile PF00566: TBC domain Length = 777 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 126 SPPSNPLVIFYDTRREEVVLLSRPQHSRNY 37 S PSNPLV F + +R+ RPQH + Y Sbjct: 15 SKPSNPLVAF-EHKRDAYGFPVRPQHVQRY 43 >At1g30780.1 68414.m03763 F-box family protein Length = 482 Score = 27.5 bits (58), Expect = 10.0 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = -2 Query: 126 SPPSNPLVIFYDTRREEVVLLSRP 55 +PP NP+++ +D R E++ + P Sbjct: 364 TPPMNPVLVCFDVRSEKISFIKAP 387 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,749,650 Number of Sequences: 28952 Number of extensions: 279502 Number of successful extensions: 632 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 632 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -