BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0353 (661 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 25 0.73 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 21 6.8 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 21 6.8 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 9.0 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 9.0 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 24.6 bits (51), Expect = 0.73 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +3 Query: 351 P*TTKLELITNCFKVSRLSVYALVKPGLLCGSIKLSRITR*VNLKD 488 P T L N V + Y LV+ S+KLS+I VNL D Sbjct: 21 PDTLAKNLGINSSFVHKEHCYVLVRLARFRDSVKLSKIPNNVNLMD 66 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 21.4 bits (43), Expect = 6.8 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = -2 Query: 273 YYVCSLYGEIPP 238 Y +C+++G +PP Sbjct: 18 YKICNIFGIVPP 29 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 21.4 bits (43), Expect = 6.8 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = -2 Query: 273 YYVCSLYGEIPP 238 Y +C+++G +PP Sbjct: 18 YKICNIFGIVPP 29 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 16 RRAHVHYYWYCVLLYVSTTILPIS 87 R+ V +WY LLY + + +S Sbjct: 277 RKPGVGVFWYARLLYATADFVLLS 300 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 219 RCFK*LLAEFHHTMNTHNNLSH 284 RC L+ H M HN +SH Sbjct: 333 RCHPLSLSSDHQAMLHHNPMSH 354 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,714 Number of Sequences: 336 Number of extensions: 3605 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -