BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0349 (769 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) 241 3e-64 SB_11655| Best HMM Match : No HMM Matches (HMM E-Value=.) 227 8e-60 SB_47946| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_46129| Best HMM Match : No HMM Matches (HMM E-Value=.) 154 9e-38 SB_53305| Best HMM Match : S-AdoMet_synt_N (HMM E-Value=0.0056) 85 8e-17 SB_16847| Best HMM Match : S-AdoMet_synt_M (HMM E-Value=0) 46 4e-05 SB_18815| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_15158| Best HMM Match : Cadherin (HMM E-Value=7.5e-23) 31 0.77 SB_30927| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_17763| Best HMM Match : IBN_N (HMM E-Value=3.4e-20) 31 1.0 SB_31747| Best HMM Match : Myotub-related (HMM E-Value=0) 29 3.1 SB_30254| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_41016| Best HMM Match : RPEL (HMM E-Value=8.9) 29 4.1 SB_28599| Best HMM Match : MSSP (HMM E-Value=6.8) 29 4.1 SB_18779| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 29 4.1 SB_6264| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_39882| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_10239| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_52707| Best HMM Match : RPEL (HMM E-Value=8.9) 29 5.5 SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) 28 9.5 SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) 28 9.5 >SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 241 bits (591), Expect = 3e-64 Identities = 110/138 (79%), Positives = 123/138 (89%) Frame = +2 Query: 131 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITKTGMVLLCGEITSKA 310 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVACET+ KTGM+LLCGEITS A Sbjct: 29 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVACETVAKTGMILLCGEITSNA 88 Query: 311 NVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGVHENRNDEEVGAGDQ 490 VDYQ VVR+ +K IGYDDS KGFDYKTC+V++AL+QQS +IA GVH R +E+VGAGDQ Sbjct: 89 VVDYQSVVRQCIKDIGYDDSEKGFDYKTCNVLVALEQQSVDIAHGVHVGREEEDVGAGDQ 148 Query: 491 GLMFGYATDETEECMPLT 544 GLMFGYATDETEE MPLT Sbjct: 149 GLMFGYATDETEELMPLT 166 Score = 57.2 bits (132), Expect = 1e-08 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 546 VVLAHKLNQKIAELRRNGEFWWARPDSKTQVTLPNMYLLGGA 671 VVLAHK+NQK+AE RR+G WARPDSKTQVT+ + G A Sbjct: 167 VVLAHKMNQKLAEYRRDGTLPWARPDSKTQVTVEYKFEHGRA 208 >SB_11655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 227 bits (555), Expect = 8e-60 Identities = 107/144 (74%), Positives = 117/144 (81%) Frame = +2 Query: 113 YDMEDGSVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITKTGMVLLCG 292 Y D FLFTSESV EGH DKMCDQISDA+LDAHL QDP AKVACET TKTG+VLL G Sbjct: 44 YSTSDCDNFLFTSESVNEGHSDKMCDQISDAVLDAHLEQDPYAKVACETATKTGLVLLFG 103 Query: 293 EITSKANVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGVHENRNDEE 472 EITS A VDYQ VVR T++ IGY+DSS GFDYKTCSV+LA+ +Q IA VH NR D+E Sbjct: 104 EITSNARVDYQAVVRNTIRDIGYNDSSTGFDYKTCSVLLAIQEQVAEIAQTVHLNRRDDE 163 Query: 473 VGAGDQGLMFGYATDETEECMPLT 544 +GAGDQGLMFGYATDETEE MPLT Sbjct: 164 IGAGDQGLMFGYATDETEELMPLT 187 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = +3 Query: 549 VLAHKLNQKIAELRRNGEFWWARPDSKTQVTLPNMYLLGGATVP 680 VLAHKL ++AE R+ W PD KTQVT+ + L GA +P Sbjct: 189 VLAHKLCARLAECRKGKILPWLLPDGKTQVTV-DYRLERGACIP 231 >SB_47946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 460 Score = 165 bits (402), Expect = 3e-41 Identities = 72/96 (75%), Positives = 88/96 (91%) Frame = +2 Query: 257 TITKTGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNI 436 ++ KTGM+++CGEITS ANVDYQKVVR+T+K IGYDDSSKGFDYKTC+V+ A++QQSP+I Sbjct: 2 SVAKTGMIVVCGEITSLANVDYQKVVRDTIKQIGYDDSSKGFDYKTCTVLQAIEQQSPDI 61 Query: 437 AAGVHENRNDEEVGAGDQGLMFGYATDETEECMPLT 544 A GVH R+DE++GAGDQGLMFGYATDET+E MPLT Sbjct: 62 AQGVHIGRSDEDLGAGDQGLMFGYATDETDELMPLT 97 Score = 54.8 bits (126), Expect = 7e-08 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = +3 Query: 546 VVLAHKLNQKIAELRRNGEFWWARPDSKTQVTLPNMYLLGGATVP 680 VVLAH LN+++A+ RRNG W RPDSKTQVT+ + GG VP Sbjct: 98 VVLAHGLNKRLADCRRNGSLPWVRPDSKTQVTVEYKF-QGGKAVP 141 >SB_46129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 154 bits (373), Expect = 9e-38 Identities = 68/82 (82%), Positives = 77/82 (93%) Frame = +2 Query: 131 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITKTGMVLLCGEITSKA 310 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVACE++ KTGM+++CGEITS A Sbjct: 9 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVACESVAKTGMIVVCGEITSLA 68 Query: 311 NVDYQKVVRETVKHIGYDDSSK 376 NVDYQKVVR+T+K IGYDDSSK Sbjct: 69 NVDYQKVVRDTIKQIGYDDSSK 90 >SB_53305| Best HMM Match : S-AdoMet_synt_N (HMM E-Value=0.0056) Length = 70 Score = 84.6 bits (200), Expect = 8e-17 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 131 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVAC 253 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVAC Sbjct: 29 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVAC 69 >SB_16847| Best HMM Match : S-AdoMet_synt_M (HMM E-Value=0) Length = 192 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/34 (55%), Positives = 26/34 (76%) Frame = +3 Query: 543 PVVLAHKLNQKIAELRRNGEFWWARPDSKTQVTL 644 PV AH+L ++ +ELRRNG W RPD+K+QVT+ Sbjct: 33 PVYYAHRLVERQSELRRNGTLPWLRPDAKSQVTI 66 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +2 Query: 467 EEVGAGDQGLMFGYATDETEECMP 538 E+ GAGDQGLMFGYAT+ET+ MP Sbjct: 8 EDQGAGDQGLMFGYATNETDSLMP 31 >SB_18815| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +3 Query: 15 RGTVWGYISGLTLNSECRRLQK*MDTRK-PTDTVMIWKMDQYFCSH 149 RG VW ++GL+ N E K + T++ PT+ V++W + + F +H Sbjct: 416 RGQVWQMMAGLSENDELVDSYKHLFTKESPTEQVIVWDIHRTFPAH 461 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +3 Query: 15 RGTVWGYISGLTLNSECRRLQK*MDTRK-PTDTVMIWKMDQYFCSH 149 RG VW ++GL+ N E K + T++ PT+ V++W + + F +H Sbjct: 70 RGQVWQMMAGLSENDELVDSYKHLFTKESPTEQVIVWDIHRTFPAH 115 >SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3259 Score = 31.9 bits (69), Expect = 0.59 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +2 Query: 395 CSVMLALDQQSPNIAAGVHENRNDEE--VGAGDQGLMFGYATDETEECMPLTRSACTQTQ 568 C +M + + P I G +E N E+ V D+ ET++ + LTRS +Q Sbjct: 2022 CDIMPTISEDPPEIQFGQNEETNFEQLMVNMLDERDKLMETLRETQDSLALTRSKLNDSQ 2081 Query: 569 SENCRAQA 592 E R A Sbjct: 2082 KEKDRLMA 2089 >SB_15158| Best HMM Match : Cadherin (HMM E-Value=7.5e-23) Length = 390 Score = 31.5 bits (68), Expect = 0.77 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +2 Query: 290 GEITSKANVDYQKVVRETV---KHIGYDDSSKGFDYK 391 GEITS N+D +K+ + K I YD G+DY+ Sbjct: 103 GEITSNVNIDREKLPGSNLLEFKAIAYDAKGAGYDYR 139 >SB_30927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 31.1 bits (67), Expect = 1.0 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = -3 Query: 701 LQYETLCGNCCTTKQIHIRQSNLCF*IWSCPPKFSISPELCNFLIEFVCKHY 546 L +TL CC+ Q H+ SN C I + +S + EL N +++C+H+ Sbjct: 110 LNLQTLSQACCSFLQTHLDASN-CLGIRAFADLYSCT-ELENAAFKYICQHF 159 >SB_17763| Best HMM Match : IBN_N (HMM E-Value=3.4e-20) Length = 681 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 512 LHNRTSSPGLLPQLPRHFCSHAPQQQCLVIVGL 414 L N T+ P + PQ P H SHA + ++I G+ Sbjct: 99 LGNETARPAIAPQEPEHLVSHANKILTVIIQGM 131 >SB_31747| Best HMM Match : Myotub-related (HMM E-Value=0) Length = 550 Score = 29.5 bits (63), Expect = 3.1 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -2 Query: 258 VSHATFASGS*FRCASRIASLIWSHILSG 172 +S + A + FRC+ R S++W H+ +G Sbjct: 287 ISDSDLAKVASFRCSGRFPSIVWRHMTNG 315 >SB_30254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 29.5 bits (63), Expect = 3.1 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = -1 Query: 694 MKLSVGTVAPPSKYIFGKVTCVFESGLAHQNSPFRLSSAIF*LSLCASTTGQRHAFFCLI 515 +KL++GT +KY GK+ + L P R S+A+ + CA+T R ++ Sbjct: 32 LKLNIGTRPIANKYREGKMKSTLKRELKRSRLPGRSSNAVDCVQ-CAATAAGREGGDFVL 90 Query: 514 CC--ITEHQA 491 C + +H A Sbjct: 91 CTHDVGDHMA 100 >SB_41016| Best HMM Match : RPEL (HMM E-Value=8.9) Length = 148 Score = 29.1 bits (62), Expect = 4.1 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = -1 Query: 694 MKLSVGTVAPPSKYIFGKVTCVFESGLAHQNSPFRLSSAIF*LSLCASTTGQRHAFFCL 518 +KL++GT +KY GK+ + L P R S+A+ + A+ G+ F L Sbjct: 75 LKLNIGTRPIANKYREGKMKSTLKRELKRSRLPGRSSNAVDCVQCAATAAGREGGDFVL 133 >SB_28599| Best HMM Match : MSSP (HMM E-Value=6.8) Length = 148 Score = 29.1 bits (62), Expect = 4.1 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = -1 Query: 694 MKLSVGTVAPPSKYIFGKVTCVFESGLAHQNSPFRLSSAIF*LSLCASTTGQRHAFFCL 518 +KL++GT +KY GK+ + L P R S+A+ + A+ G+ F L Sbjct: 75 LKLNIGTRPIANKYREGKMKSTLKRELKRSRLPGRSSNAVDCVQCAATAAGREGGDFVL 133 >SB_18779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 29.1 bits (62), Expect = 4.1 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = -1 Query: 694 MKLSVGTVAPPSKYIFGKVTCVFESGLAHQNSPFRLSSAIF*LSLCASTTGQRHAFFCL 518 +KL++GT +KY GK+ + L P R S+A+ + A+ G+ F L Sbjct: 7 LKLNIGTRPIANKYREGKMKSTLKRELKRSRLPGRSSNAVDFVQCAATAAGREGGDFVL 65 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 29.1 bits (62), Expect = 4.1 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = -1 Query: 694 MKLSVGTVAPPSKYIFGKVTCVFESGLAHQNSPFRLSSAIF*LSLCASTTGQRHAFFCL 518 +KL++GT +KY GK+ + L P R S+A+ + A+ G+ F L Sbjct: 133 LKLNIGTRPIANKYREGKMKSTLKRELKRSRLPGRSSNAVDCVQCAATAAGREGGDFVL 191 >SB_6264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 29.1 bits (62), Expect = 4.1 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = -1 Query: 694 MKLSVGTVAPPSKYIFGKVTCVFESGLAHQNSPFRLSSAIF*LSLCASTTGQRHAFFCL 518 +KL++GT +KY GK+ + L P R S+A+ + A+ G+ F L Sbjct: 7 LKLNIGTRPIANKYREGKMKSTLKRELKRSRLPGRSSNAVDCVQCAATAAGREGGDFVL 65 >SB_39882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 28.7 bits (61), Expect = 5.5 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = -1 Query: 694 MKLSVGTVAPPSKYIFGKVTCVFESGLAHQNSPFRLSSAIF*LSLCASTTGQRHAFFCL 518 +KL++GT +KY GK+ + L P R S+A+ + A+ G F L Sbjct: 21 LKLNIGTRPIANKYREGKMKSTLKRELKRSRLPGRSSNAVDCVQCAATAAGHEGGDFVL 79 >SB_10239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.7 bits (61), Expect = 5.5 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = -1 Query: 694 MKLSVGTVAPPSKYIFGKVTCVFESGLAHQNSPFRLSSAIF*LSLCASTTGQRHAFFCL 518 +KL++GT +KY GK+ + L P R S A+ + A+ G+ F L Sbjct: 7 LKLNIGTRPIANKYREGKMKSTLKRELKRSRLPGRSSDAVDCVQCAATAAGREGGDFVL 65 >SB_52707| Best HMM Match : RPEL (HMM E-Value=8.9) Length = 147 Score = 28.7 bits (61), Expect = 5.5 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = -1 Query: 694 MKLSVGTVAPPSKYIFGKVTCVFESGLAHQNSPFRLSSAIF*LSLCASTTGQRHAFFCL 518 +KL++GT +KY GK+ + L P R S+A+ + A+ G F L Sbjct: 74 LKLNIGTRPIANKYREGKMKSTLKRELKRSRLPGRSSNAVDCVQCAATAAGHEGGDFVL 132 >SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1155 Score = 28.7 bits (61), Expect = 5.5 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +2 Query: 62 MPETSKMNGYAKTNGHSYDMEDGSVFLFTSESVGE-GHPDKMCDQISDAILDAHLNQDPD 238 MP G +K N + D D +L +S+ + D++C + I AHL QDPD Sbjct: 196 MPYGGGKRGKSKKNSSTLDTGDLETWLKGRKSITRVRNHDELCAARALVIGMAHLTQDPD 255 >SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 28.3 bits (60), Expect = 7.2 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +2 Query: 62 MPETSKMNGYAKTNGHSYDMEDGSVFLFTSESVGE-GHPDKMCDQISDAILDAHLNQDPD 238 MP + G +K N + D D +L S+ + D++C + I AHL +DPD Sbjct: 241 MPFGAGKRGKSKKNSSTLDTGDLETWLKGKRSITRVRNHDELCAARATVIGMAHLTKDPD 300 >SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) Length = 2157 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +1 Query: 631 HRLLCRICICLVVQQFPQRVSYCSSCHLQHSEKIPL 738 H+L CRI C RV C+SCH S PL Sbjct: 1050 HQLSCRIWTC----SKRMRVVVCTSCHTTPSNATPL 1081 >SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) Length = 775 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/53 (30%), Positives = 23/53 (43%) Frame = +2 Query: 443 GVHENRNDEEVGAGDQGLMFGYATDETEECMPLTRSACTQTQSENCRAQAKWR 601 G H R D + G G GLM +++ + L + T EN + KWR Sbjct: 267 GYHIYRKDRKKGGG--GLMAYFSSKMASRKVKLPKHMLTAKTEENWELKRKWR 317 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,072,359 Number of Sequences: 59808 Number of extensions: 644344 Number of successful extensions: 1724 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 1600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1721 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2083999566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -