BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0340 (453 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07220.1 68414.m00768 expressed protein 40 6e-04 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 1.9 At5g42370.1 68418.m05159 expressed protein 29 1.9 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 1.9 At2g19150.1 68415.m02235 pectinesterase family protein contains ... 29 1.9 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 2.6 At1g10390.1 68414.m01171 nucleoporin family protein contains Pfa... 28 3.4 At5g22390.1 68418.m02612 expressed protein 27 4.5 At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical... 27 4.5 At3g56510.1 68416.m06284 TBP-binding protein, putative similar t... 27 5.9 At2g05210.1 68415.m00549 expressed protein 27 5.9 At2g03890.2 68415.m00352 phosphatidylinositol 3- and 4-kinase fa... 27 5.9 At2g03890.1 68415.m00351 phosphatidylinositol 3- and 4-kinase fa... 27 5.9 At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-P... 27 7.8 At3g02270.1 68416.m00208 eIF4-gamma/eIF5/eIF2-epsilon domain-con... 27 7.8 At1g76965.1 68414.m08961 glycine-rich protein 27 7.8 At1g50410.1 68414.m05650 SNF2 domain-containing protein / helica... 27 7.8 >At1g07220.1 68414.m00768 expressed protein Length = 507 Score = 40.3 bits (90), Expect = 6e-04 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 1/88 (1%) Frame = -1 Query: 444 RIRFPSKPDTPRSSEPILIPKLRIQFADFP-YLHYSID*RLFTLETCCGYGYEPARHLHV 268 R+R P K +PRS +L+ L + F F L Y +D + +T G+ EP H+ Sbjct: 6 RLRLPHK-SSPRSPSYLLLCVLALSFFSFTALLFYKVDDFIAQTKTLAGHNLEPTPW-HI 63 Query: 267 HPSPEFSRSAESIRTPPQMRCSSRSEPY 184 P FS + + + ++CS S PY Sbjct: 64 FPRKSFSAATKHSQAYRILQCSYFSCPY 91 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 1.9 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -2 Query: 242 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 108 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 181 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 71 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 1.9 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +2 Query: 44 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 175 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At2g19150.1 68415.m02235 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 339 Score = 28.7 bits (61), Expect = 1.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 212 ICGGVRILSADLENSGEGCTWRCRAGSYPYPQQV 313 I GG+ + ++ EGCT + R G YP P +V Sbjct: 185 ISGGIDFIFGGAQSIFEGCTLKLRVGIYP-PNEV 217 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 2.6 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 237 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 139 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At1g10390.1 68414.m01171 nucleoporin family protein contains Pfam profiles: PF04096 nucleoporin autopeptidase, PF03093 nucleoporin FG repeat family Length = 1041 Score = 27.9 bits (59), Expect = 3.4 Identities = 28/105 (26%), Positives = 40/105 (38%), Gaps = 5/105 (4%) Frame = -1 Query: 303 GYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRS-EPYLPSI--GFHGTRTLRQKRK 133 G+G P++ PSP F +++ + P S+ P P+I GT T Sbjct: 410 GFGISPSQPNPFSPSPAFGQTSANPTNPFSSSTSTNPFAPQTPTIASSSFGTATSNFGSS 469 Query: 132 LFPDLSAASSGHFGLPRRTLVFKDEGTIIETVPLP--GSGIGTGF 4 F S+++ G T VF T P P GS GF Sbjct: 470 PFGVTSSSNLFGSGSSTTTSVFGSSSAFGTTTPSPLFGSSSTPGF 514 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 4.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 116 ERSGKSFLFCLSVRVPWNPIEG 181 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical to DNA Helicase [Arabidopsis thaliana] GI:11121449 Length = 1188 Score = 27.5 bits (58), Expect = 4.5 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 279 HLHVHPSPEFSRSAESIRTPPQMRCSSRSE 190 H H +P+ S S S+RTPP R +SR E Sbjct: 229 HYHSTSTPQPSVSNFSLRTPPVDRSASRLE 258 >At3g56510.1 68416.m06284 TBP-binding protein, putative similar to TBP-binding protein ABT1 GI:6518527 from [Mus musculus] Length = 257 Score = 27.1 bits (57), Expect = 5.9 Identities = 17/68 (25%), Positives = 28/68 (41%) Frame = -3 Query: 208 VLFAFRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSNTRF*RRGNDY*NGSAA 29 +L + + Y P +S AQ +K G G F WV + +R D NG Sbjct: 69 ILAQYGELGRIYLAPEDSEAQVHRKRAGGFRGQRFSEGWVEFAKKSVAKRVADMLNGEQI 128 Query: 28 GFRNRNRI 5 G + ++ + Sbjct: 129 GGKKKSSV 136 >At2g05210.1 68415.m00549 expressed protein Length = 364 Score = 27.1 bits (57), Expect = 5.9 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = -1 Query: 237 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHFGLPR 82 +S T C+ +E Y +GF T TLR+KR L S +F PR Sbjct: 282 DSTATLEAFLCNKDAE-YFWGLGFQDTETLRKKRNWL--LGIRESSNFVAPR 330 >At2g03890.2 68415.m00352 phosphatidylinositol 3- and 4-kinase family protein low similarity to phosphatidylinositol 4-kinase type-II beta [Homo sapiens] GI:20159767; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 530 Score = 27.1 bits (57), Expect = 5.9 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -2 Query: 164 MELERSGRKENSSRTSRRRLQATLGYPVEHSFLKTRERLL 45 MEL+RS ++ T +RRLQ L +P E S L + +L Sbjct: 60 MELDRS----DNVHTVKRRLQIALNFPTEESSLTYGDMVL 95 >At2g03890.1 68415.m00351 phosphatidylinositol 3- and 4-kinase family protein low similarity to phosphatidylinositol 4-kinase type-II beta [Homo sapiens] GI:20159767; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 650 Score = 27.1 bits (57), Expect = 5.9 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -2 Query: 164 MELERSGRKENSSRTSRRRLQATLGYPVEHSFLKTRERLL 45 MEL+RS ++ T +RRLQ L +P E S L + +L Sbjct: 60 MELDRS----DNVHTVKRRLQIALNFPTEESSLTYGDMVL 95 >At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-PROT:P08927- RuBisCO subunit binding-protein beta subunit, chloroplast precursor (60 kDa chaperonin beta subunit, CPN-60 beta) [Pisum sativum]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 597 Score = 26.6 bits (56), Expect = 7.8 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = -1 Query: 243 SAESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHF 94 S S PP R SS + S F T+++ Q++ FP + AA HF Sbjct: 10 SMGSSLAPPSNRLSSFVS--ISSSSFGRTQSIAQRKARFPKIYAAKQLHF 57 >At3g02270.1 68416.m00208 eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein similar to SP|Q13144 Translation initiation factor eIF-2B epsilon subunit (eIF-2B GDP-GTP exchange factor) {Homo sapiens}; contains Pfam profile PF02020: eIF4-gamma/eIF5/eIF2-epsilon Length = 676 Score = 26.6 bits (56), Expect = 7.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 198 RSEPYLPSIGFHGTRTLRQKRK 133 R+ PY+P + F G RTL+ +R+ Sbjct: 288 RTFPYVPDMKFSGNRTLKLERQ 309 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 26.6 bits (56), Expect = 7.8 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 453 GTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 361 G + FP KP+ P P +P+L + F D Sbjct: 94 GAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At1g50410.1 68414.m05650 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to transcription factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 981 Score = 26.6 bits (56), Expect = 7.8 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -2 Query: 344 ILSTRGSSPWRPAADMGTNRRDISTYIPHLNFQGPQRVSGHRR 216 I TR P G++RRD+ST PH +GH + Sbjct: 15 IQETRTRPQHPPRIAEGSHRRDLSTLRPHFLSGSSSGANGHTK 57 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,323,212 Number of Sequences: 28952 Number of extensions: 254449 Number of successful extensions: 826 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 742437000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -