BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0338 (649 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 23 2.9 AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical pro... 22 3.8 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 6.6 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 209 TTYKITHLNKMYESTRKCRIY 147 T + TH N+MY S ++ IY Sbjct: 35 TEHNYTHNNEMYHSVKEEPIY 55 >AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical protein protein. Length = 148 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +2 Query: 182 YLSE*SCKL*RELGIVDSFRTVDKNVKLMCIC 277 Y + +CK+ RE+ + ++ D+ V+ IC Sbjct: 72 YTEKGTCKMGREIEVGYDLKSPDRFVRQFTIC 103 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 391 APGTMAPTITKLATSW 344 APG + P +T SW Sbjct: 416 APGLVGPLLTSALASW 431 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,056 Number of Sequences: 336 Number of extensions: 3602 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -