BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0325 (601 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0211 + 20957553-20957828,20957944-20958258,20962094-209628... 31 0.53 11_01_0284 + 2107562-2107811,2107928-2108208,2108589-2109413 27 8.7 >02_04_0211 + 20957553-20957828,20957944-20958258,20962094-20962801, 20963362-20963609,20963758-20964101,20964200-20964236, 20964270-20964575,20965281-20965347,20965498-20965626 Length = 809 Score = 31.5 bits (68), Expect = 0.53 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +1 Query: 151 SKNRTDIIKQLICYFKKTMELRLPRRASESNSKAWIFSVGFRSLEDPEQCH 303 S+ I++ L F++ + R PRR + + W+ ++ +PEQCH Sbjct: 450 SEEDETIMELLADAFQRNVSTRAPRRVPQQSGMQWV----METMNNPEQCH 496 >11_01_0284 + 2107562-2107811,2107928-2108208,2108589-2109413 Length = 451 Score = 27.5 bits (58), Expect = 8.7 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -3 Query: 89 VYNKCCKRHNCVCCKQTHYY 30 ++ CC NC+ C+Q +Y Sbjct: 315 MFTPCCCDRNCISCRQLQFY 334 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,190,380 Number of Sequences: 37544 Number of extensions: 250032 Number of successful extensions: 498 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 498 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1435654836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -