BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0325 (601 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 48 8e-06 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 48 8e-06 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 48 8e-06 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 48 8e-06 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 48 8e-06 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 48 8e-06 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 42 4e-04 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 40 0.001 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.006 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.076 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.076 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.076 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.076 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.076 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.076 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.076 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.076 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.076 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.076 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.076 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 34 0.076 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.076 SB_5068| Best HMM Match : DED (HMM E-Value=1.5e-17) 30 1.2 SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) 28 6.6 SB_11346| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_53761| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_14715| Best HMM Match : Baculo_PEP_C (HMM E-Value=0.0024) 27 8.8 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 6 DVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 62 DVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 630 DVVKRRPVNCNTTHYRANW 648 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 41 DVVKRRPVNCNTTHYRANW 59 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 3 DVVKRRPVNCNTTHYRANW 21 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 43 DVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 1881 DVVKRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 41 DVVKRRPVNCNTTHYRANW 59 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 3 DVVKRRPVNCNTTHYRANW 21 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 35 DVVKRRPVNCNTTHYRANW 53 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 84 DVVKRRPVNCNTTHYRANW 102 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 62 DVVKRRPVNCNTTHYRANW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 73 DVVKRRPVNCNTTHYRANW 91 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 49 DVVKRRPVNCNTTHYRANW 67 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGNW 544 DVVKRRPVNCNTTHYR NW Sbjct: 73 DVVKRRPVNCNTTHYRANW 91 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGN 547 DVVKRRPVNCNTTHYR N Sbjct: 23 DVVKRRPVNCNTTHYRAN 40 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 511 RELVLEGGPRDPIPPIVSRITIHWPSFYN 597 R +GG PI PIVSRITIHWP+FYN Sbjct: 30 RAAATDGGA--PIRPIVSRITIHWPAFYN 56 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 544 PIPPIVSRITIHWPSFYN 597 PI PIVS ITIHWPSFYN Sbjct: 41 PIRPIVSHITIHWPSFYN 58 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 37.9 bits (84), Expect = 0.006 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -2 Query: 600 DVVKRRPVNCNTTHYRGN 547 D KRRPVNCNTTHYR N Sbjct: 80 DGEKRRPVNCNTTHYRAN 97 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.9 bits (84), Expect = 0.006 Identities = 20/36 (55%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = +1 Query: 499 CNLQRELVLEGGPR--DPIPPIVSRITIHWPSFYNV 600 C+ LVLE P P +SRITIHWPSFYNV Sbjct: 57 CSPGDPLVLERPPPRWSSNSPYMSRITIHWPSFYNV 92 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +1 Query: 547 IPPIVSRITIHWPSFY 594 I PIVSRITIHWPSFY Sbjct: 18 IRPIVSRITIHWPSFY 33 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.014 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 553 PIVSRITIHWPSFYNV 600 P+VSRITIHW SFYNV Sbjct: 35 PVVSRITIHWTSFYNV 50 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 34.3 bits (75), Expect = 0.076 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 562 SRITIHWPSFYNV 600 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 34.3 bits (75), Expect = 0.076 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 562 SRITIHWPSFYNV 600 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.076 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 562 SRITIHWPSFYNV 600 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.076 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 562 SRITIHWPSFYNV 600 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 34.3 bits (75), Expect = 0.076 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 562 SRITIHWPSFYNV 600 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.076 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 562 SRITIHWPSFYNV 600 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 34.3 bits (75), Expect = 0.076 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 562 SRITIHWPSFYNV 600 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 34.3 bits (75), Expect = 0.076 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 562 SRITIHWPSFYNV 600 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.076 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 562 SRITIHWPSFYNV 600 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.076 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 562 SRITIHWPSFYNV 600 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 34.3 bits (75), Expect = 0.076 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 562 SRITIHWPSFYNV 600 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 34.3 bits (75), Expect = 0.076 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 562 SRITIHWPSFYNV 600 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.076 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 562 SRITIHWPSFYNV 600 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_5068| Best HMM Match : DED (HMM E-Value=1.5e-17) Length = 786 Score = 30.3 bits (65), Expect = 1.2 Identities = 22/83 (26%), Positives = 38/83 (45%) Frame = -1 Query: 553 GELGPGAPPRELVLSVNYILFTIMSKPNVLTRILDAIAETNTKVDSVQTQLNGLEESFQP 374 G L A R+L + + + K + L +L I + + + Q L +FQ Sbjct: 38 GHLESVATARDLFTELMHNCYLSKDKRDCLASLLYHIGRHDLRNRLLGKQETTLTLAFQH 97 Query: 373 LDGLPAQLTDFNTKISEIQSILT 305 GLPA++ +F + SE Q++ T Sbjct: 98 WGGLPAKVPNFVGRESECQAVFT 120 >SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) Length = 1292 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -1 Query: 421 DSVQTQLNGLEESFQPLDGLPAQLTDFNTKISEIQSIL 308 D +Q + L ++ +D L AQL + KISE+ S+L Sbjct: 803 DEMQKASSELLDTKSTMDALRAQLVEKQNKISELDSLL 840 >SB_11346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1706 Score = 27.9 bits (59), Expect = 6.6 Identities = 18/63 (28%), Positives = 29/63 (46%) Frame = -1 Query: 544 GPGAPPRELVLSVNYILFTIMSKPNVLTRILDAIAETNTKVDSVQTQLNGLEESFQPLDG 365 G P +++V V + I S P++L R+L A T S+ N + +P G Sbjct: 1249 GVTVPGKQIVAGVKQV--PIHSSPDILARVLPAPTSTPLMNVSIANPSNQSLANIKPALG 1306 Query: 364 LPA 356 +PA Sbjct: 1307 VPA 1309 >SB_53761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 284 RIRSSVTGQYGLNF*DFSVKISQLSGQTVQRLE 382 R+R+S+ QY F F +I + G TVQ+ + Sbjct: 314 RLRASILEQYVKGFVAFGCEIQKFGGYTVQKFQ 346 >SB_14715| Best HMM Match : Baculo_PEP_C (HMM E-Value=0.0024) Length = 2040 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/67 (23%), Positives = 36/67 (53%) Frame = -1 Query: 508 VNYILFTIMSKPNVLTRILDAIAETNTKVDSVQTQLNGLEESFQPLDGLPAQLTDFNTKI 329 +N + + +K + L ++ + NTKV+ T++N L L+ A++ D NTK+ Sbjct: 363 LNTKVHDLNAKVHDLNTKVNDLNTKNTKVNDQNTKVNDLNTKVHDLN---AKVHDLNTKV 419 Query: 328 SEIQSIL 308 ++ +++ Sbjct: 420 HDLNTMV 426 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,683,952 Number of Sequences: 59808 Number of extensions: 302892 Number of successful extensions: 1090 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 1030 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1089 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -